Multiple Sequence Alignment:
HINT1 Download MSA
  (        10        20        30        40        50        60        70        80        90       100       110       120      )
           |         |         |         |         |         |         |         |         |         |         |         |      
HINT1 human MADEIAkAQVARPGGDTIFGkIIRKEIPAkIIFEDDrCLAFHDIsPQAPTHFLVIPKKHISQISVAEDDDEsLLGHLMIVGKkCAADLGLNkGyRMVVNEGsDGGQsVyHVHLHVLGGRQMHWPPG
HINT1 mouse MADEIAkAQVAQPGGDTIFGkIIRKEIPAkIIFEDDRCLAFHDIsPQAPTHFLVIPKKHISQISVADDDDESLLGHLMIVGKkCAADLGLkRGYRMVVNEGADGGQSVYHIHLHVLGGRQMNWPPG
HINT1 rat MADEIAkAQVAQPGGDTIFGkIIRKEIPAkIIFEDDRCLAFHDISPQAPTHFLVIPKkHISQISVADDDDESLLGHLMIVGKKCAADLGLKRGYRMVVNEGADGGQSVYHIHLHVLGGRQMNWPPG
  ***********:******************************************************:***********************::*********:********:**********:****
Consensus MADEIAKAQVAQPGGDTIFGKIIRKEIPAKIIFEDDRCLAFHDISPQAPTHFLVIPKKHISQISVADDDDESLLGHLMIVGKKCAADLGLKRGYRMVVNEGADGGQSVYHIHLHVLGGRQMNWPPG
Modified residues are boxed in RED. Mouse-over modified sites to view residue numbers.
Aligned using Clustal Omega. Conservation and consensus calculated using von Neumann entropy from PFAAT.