Multiple Sequence Alignment:
MGC14839 Download MSA
  (        10        20        30        40        50        60        70        80        90       100       110       120       )
           |         |         |         |         |         |         |         |         |         |         |         |       
MGC14839 human MGNRVCCGGSWSCPSTFQKKKKTGSQTRRtLKPQ-PQQLQQNLPKGHEttGHtyERVLQQQGsQERSPGLMSEDsNLHyADIQVCs--RPHARE-VKHVHLENAtEyAtLRFPQAtPRYDSKNGTLV
MGC14839 mouse MGNRLCCGGTWSCPSTFQKKSKTGSHPRPTLsILKQQQLWQNGTKDYETTAPTYEQVLYPPASQKKTSNSTSEEsDLHyADIHVLRQIRPHsLHTVKCLHSESATEyATLRFPQATPQYDSNNGTLV
MGC14839 rat MGNRLCCGGSWSCPSTFQKRNKTGsQTRPTLNILKQQQLWQNGTKDYETTAPMYERVLHPSVPQKKSSDCTSEENDLHYADIHVLSQMRPHSLK-VKCLRSESATEyATLRFPQATPQYDSNNGTLV
  ****:****:*********:.****::*:**.::::***:**::*::***:::**:**.:.::*::::..:**:::******:*:::.***::..**::::*:**************:***:*****
Consensus MGNRLCCGGSWSCPSTFQKKNKTGSQTRPTLNILKQQQLWQNGTKDYETTAPTYERVLQPQASQKKSSNCTSEESDLHYADIHVLSQIRPHSLE-VKCLHSESATEYATLRFPQATPQYDSNNGTLV
Modified residues are boxed in RED. Mouse-over modified sites to view residue numbers.
Aligned using Clustal Omega. Conservation and consensus calculated using von Neumann entropy from PFAAT.