Multiple Sequence Alignment:
CGI-38 Download MSA
  (        10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170      )
           |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |      
CGI-38 human MAASTDMAGLEESFRKFAIHGDPKASGQEMNGKNWAKLCKDCKVADGKSVTGTDVDIVFSKVKGKSARVINYEEFKKALEELATKRFKGKSKEEAFDAICQLVAGKEPANVGVTKAKTGGAVDRLTDTSRYTGSHKERFDESGKGKGIAGRQDILDDsGyVsAYKNAGTYDAKVKK
CGI-38 mouse MAASTDIAGLEESFRKFAIHGDPKASGQEMNGKNWAKLCKDCKVADGKAVTGTDVDIVFSKVKAKSARVINYEEFkKALEELATkRFKGKSKEEAFDAICQLIAGKEPANIGVTKAKTGGAVDRLTDTSKYTGSHKERFDESGkGKGIAGRQDILDDSGYVsAYKNAGTYDAKVKK
CGI-38 rat
  ******:*****************************************:**************:**************************************:*******:******************:**********************************************
Consensus MAASTDIAGLEESFRKFAIHGDPKASGQEMNGKNWAKLCKDCKVADGKAVTGTDVDIVFSKVKAKSARVINYEEFKKALEELATKRFKGKSKEEAFDAICQLIAGKEPANIGVTKAKTGGAVDRLTDTSRYTGSHKERFDESGKGKGIAGRQDILDDSGYVSAYKNAGTYDAKVKK
Modified residues are boxed in RED. Mouse-over modified sites to view residue numbers.
Aligned using MAFFT. Conservation and consensus calculated using von Neumann entropy from PFAAT.