Multiple Sequence Alignment:
VPS24 Download MSA
  (        10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220    )
           |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |    
VPS24 human MGLFGkTQEKPPKELVNEWsLKIRKEMRVVDRQIRDIQREEEKVKRSVKDAAKKGQKDVCIVLAKEMIRSRKAVSkLYASKAHMNSVLMGMKNQLAVLRVAGSLQKSTEVMKAMQsLVKIPEIQAtMRELSkEMMKAGIIEEMLEDTFESMDDQEEMEEEAEMEIDRILFEITAGALGkAPSKVtDALPEPEPPGAMAAsEDEE--EEEEALEAMQSRLAtLRs
VPS24 iso2 human ------------------------------------------------------------------MIRSRKAVSKLYASKAHMNSVLMGMKNQLAVLRVAGSLQKSTEVMKAMQSLVKIPEIQATMRELSKEMMKAGIIEEMLEDTFESMDDQEEMEEEAEMEIDRILFEITAGALGKAPSKVTDALPEPEPPGAMAASEDEE--EEEEALEAMQSRLATLRS
VPS24 iso3 human
VPS24 mouse MGLFGKTQEKPPKELVNEWSLKIRKEMRVVDRQIRDIQREEEKVKRSVKDAAKKGQKEVCVVLAKEMIRSRKAVSKLYASKAHMNSVLMGMKNQLAVLRVAGSLQKSTEVMkAMQSLVKIPEIQATMRELSKEMMKAGIIEEMLEDTFESMDDQEEMEEAAEMEIDRILFEITAGALGKAPSKVTDALPEPEPAGAMAAsEEGEEEEDEEDLEAMQSRLATLRS
VPS24 rat MGLFGKTQEKPPKELVNEWSLKIRKEMRVVDRQIRDIQREEEKVKRSVKDAAKKGQKEVCVVLAKEMIRSRKAVSKLYASKAHMNSVLMGMKNQLAVLRVAGSLQKSTEVMKAMQsLVKIPEIQAtMRELSKEMMKAGIIEEMLEDTFESMDDQEEMEEAAEMEIDRILFEITAGALGKAPSkVTDALPEPEPAGAMAAsE-GDEEDDEEDLEAMQSRLATLRS
  :::::::::::::::::::::::::::::::::::::::::::::::::::::::::.::.:::::*********************************************************************************************:*********************************:*******.::..::**:*************
Consensus MGLFGKTQEKPPKELVNEWSLKIRKEMRVVDRQIRDIQREEEKVKRSVKDAAKKGQKEVCVVLAKEMIRSRKAVSKLYASKAHMNSVLMGMKNQLAVLRVAGSLQKSTEVMKAMQSLVKIPEIQATMRELSKEMMKAGIIEEMLEDTFESMDDQEEMEEAAEMEIDRILFEITAGALGKAPSKVTDALPEPEPAGAMAASEDEEEEEDEEALEAMQSRLATLRS
Modified residues are boxed in RED. Mouse-over modified sites to view residue numbers.
Aligned using Clustal Omega. Conservation and consensus calculated using von Neumann entropy from PFAAT.