Multiple Sequence Alignment:
KIAA1143 Download MSA
  (        10        20        30        40        50        60        70        80        90       100       110       120       130       140       150     )
           |         |         |         |         |         |         |         |         |         |         |         |         |         |         |     
KIAA1143 human MSKrNQVsyVrPAEPAFLArFKERVGYREGPTVETkRIQPQPPDEDGDHsDKEDEQPQVVVLKKGDLsVEEVMKIKAEIKAAKADEEPTPADGRIIYRKPVKHPsDEkysGLtAsskKkkPNEDEVN-QDsVKkNSQKQIKNSsLLsFDNEDENE
KIAA1143 mouse MSKRNQVSYVRPAEPAFLSRFKERVGYKEGPTVEtKKIQPQLPDEDGNHsDKEDEQPQVVVLKKGDLTAEEVMKIKAEIKAAKTDEEPPPADGRIVYRKPVKRSSDEKCSGLTASSKKKKTNEDDVNKQSSVRKNSQKQIKNSSLLsFDsEDENE
KIAA1143 rat MSKRNQVSYVRPAEPAFLSRFKERVGYREGPTVETkKIQPQLPDEDGNEsDKEDEQPQVVVLKKGDLTAEEVMKIKAEIKAAKADEEPPPADGRIMYRKPVKRSSDEKCSGLTASSKKKKTNEDDVNKQsPVRKNSQKQIKNSSLLSFGsEDENE
  ******************:********:********:****:*****::******************::**************:****:******.******::****:***********:***:**:*::*:***************::*****
Consensus MSKRNQVSYVRPAEPAFLSRFKERVGYREGPTVETKKIQPQLPDEDGNHSDKEDEQPQVVVLKKGDLTAEEVMKIKAEIKAAKADEEPPPADGRIIYRKPVKRSSDEKCSGLTASSKKKKTNEDDVNKQSSVRKNSQKQIKNSSLLSFDSEDENE
Modified residues are boxed in RED. Mouse-over modified sites to view residue numbers.
Aligned using Clustal Omega. Conservation and consensus calculated using von Neumann entropy from PFAAT.