Multiple Sequence Alignment:
TPD52L2 Download MSA
  (        10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220         )
           |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         
TPD52L2 human MDsAGQDINLNsPNKGLLsDsMtDVPVDTGVAARtPAVEGLtEAEEEELrAELTkVEEEIVTLRQVLAAkERHCGELkRRLGLstLGELkQNLsRsWHDVQVSSAyVkTSEkLGEWNEKVTQSDLykktQETLsQAGQkTSAALstVGsAIsRKLGDM-----------------------RNsAtFksFEDrVGtIKSKVVGDRENGsDNLPssAGsGDKPLsDPAPF
TPD52L2 iso2 human MDSAGQDINLNSPNKGLLSDSMTDVPVDTGVAARTPAVEGLTEAEEEELRAELTKVEEEIVTLRQVLAAKERHCGELKRRLGLSTLGELKQNLsRsWHDVQVssAy--------------------KkTQETLsQAGQKTSAALSTVGSAISRKLGDM-----------------------RNsATFKSFEDRVGTIKSKVVGDRENGSDNLPSSAGSGDKPLSDPAPF
TPD52L2 iso3 human MDSAGQDINLNSPNKGLLSDSMTDVPVDTGVAARTPAVEGLTEAEEEELRAELTKVEEEIVTLRQVLAAKERHCGELKRRLGLSTLGELKQNLsRsWHDVQVSsAy--------------------KKTQETLsQAGQKTSAALSTVGSAISRKLGDMRAHPFSHSFsSYSIRHsIsMPAMRNSATFKSFEDRVGTIKSKVVGDRENGSDNLPSSAGSGDKPLSDPAPF
TPD52L2 iso4 human MDSAGQDINLNSPNKGLLSDSMTDVPVDTGVAARTPAVEGLTEAEEEELRAELTKVEEEIVTLRQVLAAKERHCGELKRRLGLSTLGELKQNLSRsWHDVQVSsAy--------------------KKTQETLsQAGQKTSAALSTVGsAISRKLGDM---------SSYSIRHsIsMPAMRNSATFKSFEDRVGTIKSKVVGDRENGSDNLPSSAGSGDKPLSDPAPF
TPD52L2 iso5 human MDSAGQDINLNSPNKGLLSDSMTDVPVDTGVAARTPAVEGLTEAEEEELRAELTKVEEEIVTLRQVLAAKERHCGELKRRLGLSTLGELKQNLSRSWHDVQVSSAYVKTSEKLGEWNEKVTQSDLYKKTQETLSQAGQKTSAALSTVGSAISRKLGDM---------SSYSIRHsIsMPAMRNSATFKSFEDRVGTIKSKVVGDRENGSDNLPSSAGSGDKPLSDPAPF
TPD52L2 iso7 human MDSAGQDINLNSPNKGLLSDSMTDVPVDTGVAARTPAVEGLTEAEEEELRAELTKVEEEIVTLRQVLAAKERHCGELKRRLGLSTLGELKQNLSRSWHDVQVSSAYVKTSEKLGEWNEKVTQSDLYKKTQETLSQAGQKTSAALSTVGSAISRKLGDMRAHPFSHSFsSYSIRHsIsMPAMRNSATFKSFEDRVGTIKSKVVGDRENGSDNLPSSAGSGDKPLSDPAPF
TPD52L2 mouse MDsAsQDINLNsPNKGVLsDFMTDVPVDPGVVHRTPVVEGLTEGEEEELRAELAkVEEEIVTLRQVLAAKERHCGELKRRLGLSTLGELkQNLsRsWHDVQVSTAyVkTSEkLGEWNEKVtQSDLYKKTQETLsQAGQKTSAALSTMGSAISRKLGDM---------SSYSIRHSIsMPVMRNsAtFKsFEDRVGtIKSKVVGGRENGsDNLPPsPGsGDQtLPDHAPF
TPD52L2 iso2 mouse MDSASQDINLNSPNKGVLSDFMTDVPVDPGVVHRTPVVEGLTEGEEEELRAELAKVEEEIVTLRQVLAAKERHCGELKRRLGLSTLGELKQNLSRsWHDVQVsTAY--------------------KKTQETLSQAGQKTSAALSTMGSAISRKLGDM-----------------------RNsATFKSFEDRVGTIKSKVVGGRENGSDNLPPSPGSGDQTLPDHAPF
TPD52L2 iso3 mouse MDSASQDINLNSPNKGVLSDFMTDVPVDPGVVHRTPVVEGLTEGEEEELRAELAKVEEEIVTLRQVLAAKERHCGELKRRLGLSTLGELKQNLSRSWHDVQVSTAYVKTSEKLGEWNEKVTQSDLYKKTQETLSQAGQKTSAALSTMGSAISRKLGDMRAHPLsQsFsSYsIRHSISMPVMRNSATFKSFEDRVGTIKSKVVGGRENGSDNLPPSPGSGDQTLPDHAPF
TPD52L2 iso4 mouse MDSASQDINLNSPNKGVLSDFMTDVPVDPGVVHRTPVVEGLTEGEEEELRAELAKVEEEIVTLRQVLAAKERHCGELKRRLGLSTLGELKQNLSRSWHDVQVSTAYVKTSEKLGEWNEKVTQSDLYKKTQETLSQAGQKTSAALSTMGSAISRKLGDM---------SSYSIRHSISMPVMRNSATFKSFEDRVGTIKsQVVGGRENGsDNLPP--GSGDQTLPDHAPF
TPD52L2 rat MDSASQDINLNsPNKGVLSDFMTDVPVDPGVVHRTPAVEGLTEVEEEELRAELAKVEEEIVTLRQVLAAkERHCGELKRRLGLSTLGELkQNLSRsWHDVQGSTAYVKTSEKLGEWNEKVTQSDLYKKTQETLSQAGQKTSAALSTMGSAISRKLGDM---------SSYSIRHSISMPVMRNSATFKsFEDRVGTIKSKVVGGRENGSDTLPssPGsGDQtLPDHAPF
TPD52L2 cow MDSAGQDINLNSPNKGLLSDSMTDVPVDTAVAAQAPAVEGLTETEAEELRAELAKVEEEIVTLRQVLAAKERHCGELKRKLGLSTLEGLKQNLSRSWHDMQVSNAYMKTSEKLGEWNEKVTQSDLYKKTQETLSQAGQKTSAALSTMGSAISRKLGDMRARPFSHSFSSHSIRHSISMPAMRNSATFKSFEDRVGTIKSKVVGGRENGGDNLPSPTGSGDRPLPDHIPF
  ****:***********:***:*******::*::::*:******:*:*******:*************************:******::***********:*:*:**.:::::::::::::::::::********************:***********.. . . ..::::::::::::.:******************:***:****:*:**:::****::*:*::**
Consensus MDSAGQDINLNSPNKGLLSDSMTDVPVDTGVAARTPAVEGLTEAEEEELRAELAKVEEEIVTLRQVLAAKERHCGELKRRLGLSTLGELKQNLSRSWHDVQVSSAYVKTSEKLGEWNEKVTQSDLYKKTQETLSQAGQKTSAALSTMGSAISRKLGDM---------SSYSIRHSISMPAMRNSATFKSFEDRVGTIKSKVVGDRENGSDNLPSSAGSGDKPLPDHAPF
Modified residues are boxed in RED. Mouse-over modified sites to view residue numbers.
Aligned using Clustal Omega. Conservation and consensus calculated using von Neumann entropy from PFAAT.