Multiple Sequence Alignment:
LBH Download MSA
  (        10        20        30        40        50        60        70        80        90       100       )
           |         |         |         |         |         |         |         |         |         |       
LBH human MSIYFP--IHCPDYLRsAKMTEVMMNTQPMEEIGLsPRKDGLSYQIFPDPSDFDRCCKLKDRLPsIVVEPtEGEVEsGELRWPPEEFLVQEDEQDNCEETAKENKEQ
LBH mouse MSVYFP--IHCSDYLRSAEMTEVMMNAPSMEEIGLSPRkDGLSYQIFPDPSDFDRCCKLKDRLPsIVVEPTEGEVESGELRWPPEEFLVQEDEQDNCEETTNEKKDQ
LBH rat -TVQFPLEIHGSDYLRSAEMTEVMMNAPSMEEIGLSPRKDGLSYQIFPDPSDFDRCCKLkDRLPsIVVEPTEGEVESGELRWPPEEFLVQEDEQDNCEETTKEKKDQ
  ::::**..**::******:*******:::***********************************************************************::*:*:*
Consensus MSVYFP--IHCSDYLRSAEMTEVMMNAPSMEEIGLSPRKDGLSYQIFPDPSDFDRCCKLKDRLPSIVVEPTEGEVESGELRWPPEEFLVQEDEQDNCEETTKEKKDQ
Modified residues are boxed in RED. Mouse-over modified sites to view residue numbers.
Aligned using Clustal Omega. Conservation and consensus calculated using von Neumann entropy from PFAAT.