Multiple Sequence Alignment:
SMAP1L Download MSA
  (        10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       350       360       370       380       390       400       410       420         )
           |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         
SMAP1L human MTGKSVkDVDRYQAVLANLLLEEDNkFCADCQSKGPRWASWNIGVFICIRCAGIHRNLGVHISRVKsVNLDQWTQEQIQCMQEMGNGkANRLYEAyLPETFRRPQIDPAVEGFIRDKYEKKKYMDRsLDINAFRkEKDDKWKRGsEPVPEkkLEPVVFEKVKMPQKKEDPQLPRKssPKstAPVMDLLGLDAPVACSIANSKtSNTLEkDLDLLAsVPsPSssGsRKVVGsMPtAGsAGsVPENLNLFPEPGSKSEEIGKKQLSKDSILSLYGSQTPQMPTQAMFMAPAQMAYPTAYPSFPGVTPPNSIMGSMMPPPVGMVAQPGASGMVAPMAMPAGYMGGMQASMMGVPNGMMTTQQAGYMAGMAAMPQTVYGVQPAQQLQWNLTQMTQQMAGMNFYGANGMMNYGQSMSGGNGQAANQTLSPQMWK
SMAP1L mouse MTGKSVKDVDRYQAVLANLLLEEDNKFCADCQSKGPRWASWNIGVFICIRCAGIHRNLGVHISRVKSVNLDQWTQEQIQCMQEMGNGKANRLYEAyLPETFRRPQIDPAVEGFIRDKYEKKKYMDRSLDINVLRKEKDDKWKRGNEPAPEKKMEPVVFEKVKMPQKKEDAQLPRKSSPKsAAPVMDLLGLDAPVACsIANSKTSNALEKDLDLLAsVPsPssV-SRKAVGsMPTAGsAGsVPENLNLFPEPGSKSEETGKKQLSKDSILSLYGSQTPQMPAQAMFMAPAQMAYPTAYPSFPGVTPPNSIMGGMVPPPVGMVAQPGASGMLTPMAMPAGYMGGMQASMMGVPNGMMTTQQAGYMASMAAMPQTVYGVQPAQQLQWNLTQMTQQMAGMNFYGANGMMNYGQSMGGGNGQAANQTLSPQMWK
SMAP1L rat MTGKSVKDVDRYQAVLANLLLEEDNKFCADCQSKGPRWASWNIGVFICIRCAGIHRNLGVHISRVKSVNLDQWTQEQIQCMQEMGNGKANRLyEAYLPETFRRPQIDPAVEGFIRDKYEKKKYMDRSLDINVLRKEKDDkWkRGSEPAPEKKMEPVVFEKVKMPQKKEDAQLPRKSSPKSAAPVMDLLGLDAPVACSIANSKTSNALEKDLDLLASVPsPSSV-SRKAVGSMPTAGSAGsVPENLNLFPEPGSKSEETGKKQLSKDSILSLYGSQTPQMPAQAMFMAPAQMAYPTAYPSFPGVTPPNSIMGSMMPPPVGMVAHPGASGMVTPMAMPAGYMGGMQASMAGVPSGMMTTQQAGYMASMAAMPQTVYGVQPAQQLQWNLTQMTQQMAGMNFYGANGMMSYGQSMGGGNGQAANQTLSPQMWK
  ***********************************************************************************************************************************::***********:**:****:****************:**********:************************:****************:.***:*****************************:**********************:******************************:*:********:******::****************:***:************:****************************************:*****:*****************
Consensus MTGKSVKDVDRYQAVLANLLLEEDNKFCADCQSKGPRWASWNIGVFICIRCAGIHRNLGVHISRVKSVNLDQWTQEQIQCMQEMGNGKANRLYEAYLPETFRRPQIDPAVEGFIRDKYEKKKYMDRSLDINVLRKEKDDKWKRGSEPAPEKKMEPVVFEKVKMPQKKEDAQLPRKSSPKSAAPVMDLLGLDAPVACSIANSKTSNALEKDLDLLASVPSPSSV-SRKAVGSMPTAGSAGSVPENLNLFPEPGSKSEETGKKQLSKDSILSLYGSQTPQMPAQAMFMAPAQMAYPTAYPSFPGVTPPNSIMGSMMPPPVGMVAQPGASGMVTPMAMPAGYMGGMQASMMGVPNGMMTTQQAGYMASMAAMPQTVYGVQPAQQLQWNLTQMTQQMAGMNFYGANGMMNYGQSMGGGNGQAANQTLSPQMWK
Modified residues are boxed in RED. Mouse-over modified sites to view residue numbers.
Aligned using MAFFT. Conservation and consensus calculated using von Neumann entropy from PFAAT.