Multiple Sequence Alignment:
CGRP-RCP Download MSA
  (        10        20        30        40        50        60        70        80        90       100       110       120       130       140        )
           |         |         |         |         |         |         |         |         |         |         |         |         |         |        
CGRP-RCP human MEVKDANSALLSNYEVFQLLTDLkEQRKESGKNkHSsGQQNLNTItyETLkYISktPCRHQsPEIVREFLTALkSHKLTKAEKLQLLNHRPVTAVEIQLMVEESEERLTEEQIEALLHTVTSILPAEPEAEQKkNTNSNVAMDEEDPA
CGRP-RCP mouse MEVKDANAALLSNYEVFQLLTDLKEQRKESGKNKHSAGQQNLNAITYETLKYISKTPCRNQSPAIVQEFLTAMKSHKLTKAEKLQLLNHRPMTAVEIQLMVEESEERLTEEQIEALLHTVTSILPAGPEDEQSKSTSNDVAMEEEEPA
  *******:****************************:******:***************:***:**:*****:******************:**********************************:**:**:*:*:::***:**:**
Consensus MEVKDANAALLSNYEVFQLLTDLKEQRKESGKNKHSAGQQNLNAITYETLKYISKTPCRNQSPAIVREFLTALKSHKLTKAEKLQLLNHRPMTAVEIQLMVEESEERLTEEQIEALLHTVTSILPAEPEAEQKKNTNNNVAMDEEDPA
Modified residues are boxed in RED. Mouse-over modified sites to view residue numbers.
Aligned using MAFFT. Conservation and consensus calculated using von Neumann entropy from PFAAT.