Multiple Sequence Alignment:
PEA-15 Download MSA
  (        10        20        30        40        50        60        70        80        90       100       110       120       130)
           |         |         |         |         |         |         |         |         |         |         |         |         |
PEA-15 human MAEyGtLLQDLTNNITLEDLEQLKsACkEDIPSEKSEEITTGsAWFSFLESHNKLDKDNLsYIEHIFEISRRPDLLTMVVDYRTRVLKIsEEDELDtkLtRIPsAKKykDIIRQPsEEEIIKLAPPPKKA
PEA-15 mouse MAEYGtLLQDLTNNITLEDLEQLKsACKEDIPSEKSEEITTGSAWFSFLESHNkLDKDNLsYIEHIFEISRRPDLLTMVVDYRTRVLKIsEEEELDTkLtRIPsAKKyKDIIRQPsEEEIIKLAPPPKKA
PEA-15 rat MAEYGTLLQDLTNNITLEDLEQLKSACKEDIPSEKSEEITTGSAWFSFLESHNKLDKDNLsYIEHIFEISRRPDLLTMVVDYRTRVLKIsEEDELDTkLTRIPsAKKYKDIIRQPsEEEIIKLAPPPKKA
PEA-15 hamster MAEYGTLLQDLTNNITLEDLEQLKSACKEDIPSEKSEEITTGSAWFSFLESHNKLDKDNLSYIEHIFEISRRPDLLTMVVDYRTRVLKISEEDELDTKLTRIPsAKKYKDIIRQPsEEEIIKLAPPPKKA
PEA-15 cow MAEYGTLLQDLTNNITLEDLEQLKSACKEDIPSEKSEEITTGSAWFSFLESHNKLDKDNLSYIEHIFEISRRPDLLTMVVDYRTRVLKISEEDELDTKLTRIPsAKKYKDIIRQPsEEEIIKLAPPPKKA
  ********************************************************************************************:*************************************
Consensus MAEYGTLLQDLTNNITLEDLEQLKSACKEDIPSEKSEEITTGSAWFSFLESHNKLDKDNLSYIEHIFEISRRPDLLTMVVDYRTRVLKISEEDELDTKLTRIPSAKKYKDIIRQPSEEEIIKLAPPPKKA
Modified residues are boxed in RED. Mouse-over modified sites to view residue numbers.
Aligned using Clustal Omega. Conservation and consensus calculated using von Neumann entropy from PFAAT.