Multiple Sequence Alignment:
14-3-3 sigma Download MSA
  (        10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240        )
           |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |        
14-3-3 sigma human MERAsLIQkAkLAEQAERyEDMAAFMKGAVEkGEELSCEERNLLsVAykNVVGGQRAAWRVLssIEQksNEEGsEEkGPEVREYREkVETELQGVCDTVLGLLDSHLIkEAGDAEsRVFYLkMkGDyyRyLAEVAtGDDkkRIIDsARsAyQEAMDISkkEMPPTNPIRLGLALNFSVFHYEIANsPEEAISLAKTTFDEAMADLHtLsEDSYkDstLIMQLLRDNLTLWTADNAGEEGGEAPQEPQs
14-3-3 sigma iso2 human MERASLIQKAKLAEQAERYEDMAAFMKGAVEKGEELSCEERNLLSVAYKNVVGGQRAAWRVLSSIEQKSNEEGSEEKGPEVREY--------------------------------RVFYLKMKGDYYRYLAEVATGDDKKRIIDSARSAYQEAMDISKKEMPPTNPIRLGLALNFSVFHYEIANSPEEAISLAKTTFDEAMADLHTLSEDSYKDSTLIMQLLRDNLTLWTADNAGEEGGEAPQEPQS
14-3-3 sigma mouse MERASLIQKAkLAEQAERyEDMAAFMKsAVEKGEELSCEERNLLsVAyKNVVGGQRAAWRVLssIEQKsNEEGsEEKGPEVKEYREKVEtELRGVCDtVLGLLDSHLIkGAGDAEsRVFYLkMkGDYyRYLAEVAtGDDKKRIIDSARSAYQEAMDISKKEMPPTNPIRLGLALNFSVFHYEIANsPEEAISLAKTTFDEAMADLHTLSEDSYKDsTLIMQLLRDNLTLWTADSAGEEGGEAPEEPQS
  ***************************:*****************************************************:**::::::::.::::::::::::::::.::::::*********************************************************************************************************************:*********:****
Consensus MERASLIQKAKLAEQAERYEDMAAFMKGAVEKGEELSCEERNLLSVAYKNVVGGQRAAWRVLSSIEQKSNEEGSEEKGPEVREYREKVETELRGVCDTVLGLLDSHLIKEAGDAESRVFYLKMKGDYYRYLAEVATGDDKKRIIDSARSAYQEAMDISKKEMPPTNPIRLGLALNFSVFHYEIANSPEEAISLAKTTFDEAMADLHTLSEDSYKDSTLIMQLLRDNLTLWTADNAGEEGGEAPQEPQS
Modified residues are boxed in RED. Mouse-over modified sites to view residue numbers.
Aligned using Clustal Omega. Conservation and consensus calculated using von Neumann entropy from PFAAT.