Multiple Sequence Alignment:
14-3-3 beta Download MSA
  (        10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240      )
           |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |      
14-3-3 beta human MtMDksELVQkAkLAEQAERyDDMAAAMkAVtEQGHELsNEERNLLsVAykNVVGARRssWRVISsIEQkTERNEKkQQMGkEYREkIEAELQDICNDVLELLDkyLIPNATQPEskVFyLkMkGDyFRyLsEVAsGDNkQTTVSNSQQAyQEAFEISkkEMQPTHPIRLGLALNFSVFyYEILNsPEKACSLAkTAFDEAIAELDtLNEEsykDstLIMQLLRDNLtLWtsENQGDEGDAGEGEN
14-3-3 beta iso2 human --MDKSELVQKAKLAEQAERYDDMAAAMKAVTEQGHELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTERNEKKQQMGKEYREKIEAELQDICNDVLELLDKYLIPNATQPESKVFYLKMKGDYFRYLSEVASGDNKQTTVSNSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLNEESYKDSTLIMQLLRDNLTLWTSENQGDEGDAGEGEN
14-3-3 beta mouse MtMDksELVQkAkLAEQAERYDDMAAAMkAVTEQGHELSNEERNLLsVAykNVVGARRSsWRVIssIEQkTERNEKKQQMGKEYREKIEAELQDICNDVLELLDKYLILNATQAEsKVFYLkMkGDYFRyLSEVAsGENkQTTVSNSQQAYQEAFEISkkEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAkTAFDEAIAELDTLNEESYKDSTLIMQLLRDNLTLWTSENQGDEGDAGEGEN
14-3-3 beta rat MTMDkSELVQkAkLAEQAERyDDMAAAMkAVTEQGHELSNEERNLLsVAYkNVVGARRSsWRVIsSIEQkTERNEKKQQMGKEYREKIEAELQDICSDVLELLDKYLILNATHAESKVFYLkMkGDYFRYLsEVASGDNkQTtVSNSQQAYQEAFEISkKEMQPTHPIRLGLALNFSVFYYEILNsPEKACSLAKTAFDEAIAELDTLNEESYKDSTLIMQLLRDNLTLWTSENQGDEGDAGEGEN
14-3-3 beta sheep MTMDKSELVQKAKLAEQAERYDDMAAAMKAVTEQGHELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTERNEKKQQMGKEY-------------------------------------KMKGDYFRYLSEVASGDNKQTTVSNSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNsPE------------AIAELDTLNEESYKDSTLIMQLLRDNLTLWTSENQGDEGDAG----
  ::**********************************************************************************::::::::::::.:::::::::::.:::.::::::::****************:**************************************************::::::::::::******************************************::::
Consensus MTMDKSELVQKAKLAEQAERYDDMAAAMKAVTEQGHELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTERNEKKQQMGKEYREKIEAELQDICNDVLELLDKYLILNATQAESKVFYLKMKGDYFRYLSEVASGDNKQTTVSNSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLNEESYKDSTLIMQLLRDNLTLWTSENQGDEGDAGEGEN
Modified residues are boxed in RED. Mouse-over modified sites to view residue numbers.
Aligned using Clustal Omega. Conservation and consensus calculated using von Neumann entropy from PFAAT.