Multiple Sequence Alignment:
GCET2 Download MSA
  (        10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180     )
           |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |     
GCET2 human MGNSLLREN--RRQQNtQEMPWNVRMQSPKQRTSRCWD----HHIAEGCFCLPWKKILIFEkRQDsQNENERMSStPIQDNVDQtysEELCytLINHRVLCtRPsGNsAEEyyENVPCkAERPREsLGGTEtEySLLHMPSTDPRHARsPEDEyELLMPHRIsSHFLQQPRPLMAPSETQFSHL-
GCET2 iso2 human MGNSLLRENSFRRQQNTQEMPWNVRMQSPKQRTSRCWD----HHIAEGCFCLPWKKILIFEKRQDSQNENERMSSTPIQDNVDQTYSEELCYTLINHRVLCTRPSGNSAEEYYENVPCKAERPRESLGGTETEYSLLHMPSTDPRHARSPEDEYELLMPHRISSHFLQQPRPLMAPSETQFSHL-
GCET2 mouse MGNCLQRTT--RWQLDMQETPWNLRLS-AKGRTCRYFRGWSCCHSVEGCSCLPWKNIRTFKARQESPKQNEGMTSAPVQDNANETYTEELCYILVDHEAVRGRPsVNPAEGFyENISNKAERHKESSRGTETEYSVLRFPSPP-QPLPSTDDEYELLMPSRFSSHAFQQPRPLTTPYETHFSYPQ
GCET2 rat MGNCLQRTT--RWQLDMQETPWNLRLQNAKGRPCRYFKGWSCCHIVEGCSCLPWKNISTFKARQESPKQNEGMTSAPIQDNANETYTEELCYILVDHKALRGRPSGKPAEGLYENISNKVDRHRESSRGTETEYSVLRFSSTS-QPLPSTEDEYELLVPSRFSSYANQQPQPLTAPFETHFSHLQ
  ***:*:*::  *:*:::**:***:*::.:*:*::*::.....:*::***:*****:*.:*::**:*:::**:*:*:*:***:::**:*****:*::*.::::***:::**:.***:::*::*::**::*******:*:::*:..::::*::******:*:*:**::.***:**::*.**:**::.
Consensus MGNCLQREN--RRQQNMQEMPWNLRLQSAKQRTCRCFDGWSCCHIAEGCFCLPWKNILIFEARQDSQNQNERMSSAPIQDNANQTYSEELCYILINHRALRGRPSGNPAEEYYENIPNKAERHRESLRGTETEYSLLRMPSTDPRHARSPEDEYELLMPHRISSHALQQPRPLMAPSETQFSHLQ
Modified residues are boxed in RED. Mouse-over modified sites to view residue numbers.
Aligned using Clustal Omega. Conservation and consensus calculated using von Neumann entropy from PFAAT.