Multiple Sequence Alignment:
hnRNP D0 Download MSA
  (        10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       350      )
           |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |      
hnRNP D0 human MsEEQFGGDGAAAAATAAVGGSAGEQEGAMVAAT-QGAAAAAGSGAGTGGGTASGGTEGGSAESEGAKIdAskNEEDEGHsNssPRHsEAAtAQrEEWkMFIGGLsWDTTkkDLkDYFSkFGEVVDCtLkLDPItGRsrGFGFVLFkESESVDkVMDQkEHkLNGkVIDPKRAKAMKTKEPVKkIFVGGLsPDtPEEkIREyFGGFGEVEsIELPMDNkTNKRRGFCFITFkEEEPVKkIMEKkyHNVGLSkCEIkVAMSkEQyQQQQQWGsrGGFAGrArGrGGGPSQNWNQGYSNYWNQGYGNYGYNSQGYGGYGGYDYTGYNNYyGyGDySNQQSGYGKVSRrGGHQNsykPy
hnRNP D0 iso2 human MSEEQFGGDGAAAAATAAVGGSAGEQEGAMVAAT-QGAAAAAGSGAGTGGGTASGGTEGGSAESEGAKIDASKNEEDEG-------------------KMFIGGLSWDTTKKDLKDYFSKFGEVVDCTLKLDPITGRSRGFGFVLFKESESVDKVMDQKEHKLNGKVIDPKRAKAMKTKEPVKKIFVGGLSPDTPEEKIREYFGGFGEVESIELPMDNKTNKRRGFCFITFKEEEPVKKIMEKKYHNVGLSKCEIKVAMSKEQYQQQQQWGSRGGFAGRARGRGGGPSQNWNQGYSNYWNQGYGNYGYNSQGYGGYGGYDYTGYNNYYGYGDYSNQQSGYGKVSRRGGHQNSYKPY
hnRNP D0 iso3 human MSEEQFGGDGAAAAATAAVGGSAGEQEGAMVAATQG-AAAAAGSGAGTGGGTASGGTEGGSAESEGAKIDASKNEEDEGHSNSsPRHsEAATAQREEWKMFIGGLSWDTTKKDLKDYFSKFGEVVDCTLKLDPITGRSRGFGFVLFKESESVDKVMDQkEHKLNGKVIDPKRAKAMKTKEPVKKIFVGGLSPDtPEEKIREYFGGFGEVESIELPMDNKTNKRRGFCFITFKEEEPVKKIMEKKYHNVGLSKCEIKVAMSKEQYQQQQQWGSrGGFAGrArGrGGD-------------------------------------------------QQsGyGkVsRRGGHQNSYKPY
hnRNP D0 mouse MSEEQFGGDGAAAAATAAVGGSAGEQEGAMVAAAAQGPAAAAGSGSG-GGGSAAGGTEGGsAEAEGAKIDAsKNEEDEGHsnssPRHTEAAAAQREEWKMFIGGLSWDTTkKDLkDYFSkFGEVVDCtLkLDPITGRSRGFGFVLFKESESVDkVMDQKEHKLNGkVIDPKRAKAMKtKEPVKKIFVGGLsPDtPEEkIREYFGGFGEVESIELPMDNkTNKRRGFCFITFKEEEPVkKIMEKKYHNVGLSkCEIKVAMSKEQYQQQQQWGSrGGFAGrArGrGGGPSQNWNQGYSNYWNQGYGNYGYNSQGYGGYGGYDYTGYNNYYGYGDYSNQQSGYGKVSrrGGHQNSYKPY
hnRNP D0 iso3 mouse MSEEQFGGDGAAAAATAAVGGSAGEQEGAMVAAAAQGPAAAAGSG-SGGGGSAAGGTEGGSAEAEGAKIDASKNEEDEGHSNSSPRHTEAAAAQREEWKMFIGGLSWDTTKKDLKDYFSKFGEVVDCTLKLDPITGRSRGFGFVLFKESESVDKVMDQKEHKLNGKVIDPKRAKAMKTKEPVKKIFVGGLSPDTPEEKIREYFGGFGEVESIELPMDNKTNKRRGFCFITFKEEEPVKKIMEKKYHNVGLSKCEIKVAMSKEQYQQQQQWGSrGGFAGrArGrGGD-------------------------------------------------QQSGYGKVSrRGGHQNSYKPY
hnRNP D0 rat MSEEQFGGDGAAAAATAAVGGSAGEQEGAMVAAAQ-GAA--AAAGSGSGGGSAAGGTEGGSTEAEGAKIDASkNEEDEGHsNssPRHTEAATAQREEWKMFIGGLSWDTTkKDLkDYFSKFGDVVDCTLKLDPITGRSRGFGFVLFKESESVDkVMDQKEHKLNGkVIDPkRAKAMKTKEPVKKIFVGGLsPDTPEEkIREYFGGFGEVESIELPMDNKTNKRRGFCFITFKEEEPVKKIMEKkYHNVGLSKCEIKVAMSKEQYQQQQQWGSrGGFAGrARGRGGGPSQNWNQGYSNYWNQGYGSYGYNSQGYGGYGGYDYTGYNSYYGYGDYSNQQSGYGKVSRrGGHQNSYKPY
hnRNP D0 iso2 rat MSEEQFGGDGAAAAATAAVGGSAGEQEGAMVAAAQ-GAA--AAAGSGSGGGSAAGGTEGGSTEAEGAKIDASkNEEDEG-------------------KMFIGGLSWDTTKKDLKDYFSKFGDVVDCTLKLDPITGRSRGFGFVLFKESESVDKVMDQKEHKLNGKVIDPKRAKAMKTKEPVKKIFVGGLSPDTPEEKIREYFGGFGEVESIELPMDNKTNKRRGFCFITFKEEEPVKKIMEKKYHNVGLSKCEIKVAMSKEQYQQQQQWGSRGGFAGRARGRGGGPSQNWNQGYSNYWNQGYGSYGYNSQGYGGYGGYDYTGYNSYYGYGDYSNQQSGYGKVSRRGGHQNSYKPY
hnRNP D0 iso4 rat -----------------------------------------------------------------------------------------------------------------------------------------------------ESVDKVMDQKEHKLNGKVIDPKRAKAMKTKEPVKKIFVGGLSPDTPEEKIREYFGGFGEVESIELPMDNKTNKRRGFCFITFKEEEPVKKIMEKKYHNVGLSKCEIKVAMSKEQYQQQQQWGSRGGFAGRARGRGGD-------------------------------------------------QQSGYGkVSRRGGHQNSYKPY
  ::::::::::::::::::::::::::::::::::..:::..::::::.:::::::::::::::::::::::::::::::...................:::::::::::::::::::::::::::::::::::::::::::::::::::****************************************************************************************************************************************:.................................................*********************
Consensus MSEEQFGGDGAAAAATAAVGGSAGEQEGAMVAAAQQGAAAAAGSGAGTGGGSAAGGTEGGSAEAEGAKIDASKNEEDEGHSNSSPRHTEAATAQREEWKMFIGGLSWDTTKKDLKDYFSKFGEVVDCTLKLDPITGRSRGFGFVLFKESESVDKVMDQKEHKLNGKVIDPKRAKAMKTKEPVKKIFVGGLSPDTPEEKIREYFGGFGEVESIELPMDNKTNKRRGFCFITFKEEEPVKKIMEKKYHNVGLSKCEIKVAMSKEQYQQQQQWGSRGGFAGRARGRGGGPSQNWNQGYSNYWNQGYGNYGYNSQGYGGYGGYDYTGYNNYYGYGDYSNQQSGYGKVSRRGGHQNSYKPY
Modified residues are boxed in RED. Mouse-over modified sites to view residue numbers.
Aligned using Clustal Omega. Conservation and consensus calculated using von Neumann entropy from PFAAT.