Multiple Sequence Alignment:
PDE6G Download MSA
  (        10        20        30        40        50        60        70        80       )
           |         |         |         |         |         |         |         |       
PDE6G human MNLEPPKAEFRSATRVAGGPVtPRkGPPKFKQRQTrQFKSKPPKKGVQGFGDDIPGMEGLGTDITVICPWEAFNHLELHELAQYGII
PDE6G mouse MNLEPPKGEIRSATRVIGGPVtPRKGPPKFKQRQtRQFKSKPPKKGVQGFGDDIPGMEGLGtDITVICPWEAFNHLELHELAQYGII
PDE6G cow MNLEPPKAEIRSATRVMGGPVtPRKGPPKFKQRQtRQFKSKPPKKGVQGFGDDIPGMEGLGTDITVICPWEAFNHLELHELAQYGII
  *******:*:******:**********************************************************************
Consensus MNLEPPKAEIRSATRVAGGPVTPRKGPPKFKQRQTRQFKSKPPKKGVQGFGDDIPGMEGLGTDITVICPWEAFNHLELHELAQYGII
Modified residues are boxed in RED. Mouse-over modified sites to view residue numbers.
Aligned using Clustal Omega. Conservation and consensus calculated using von Neumann entropy from PFAAT.