Multiple Sequence Alignment:
H2AX Download MSA
  (        10        20        30        40        50        60        70        80        90       100       110       120       130       140  )
           |         |         |         |         |         |         |         |         |         |         |         |         |         |  
H2AX human SGRGkTGGkARAkAksRSsrAGLQFPVGrVHRLLRkGHyAERVGAGAPVYLAAVLEyLTAEILELAGNAARDNKKTRIIPrHLQLAIrNDEELNkLLGGVtIAQGGVLPNIQAVLLPkktsAtVGPkAPsGGkkAtQAsQEy
H2AX mouse SGRGkTGGkARAKAKSRSSRAGLQFPVGRVHRLLRKGHYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNkLLGGVTIAQGGVLPNIQAVLLPkkssATVGPkAPAVGkKAsQAsQEy
H2AX rat SGRGkTGGkARAKAKSRSSRAGLQFPVGRVHRLLRKGHYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGGVtIAQGGVLPNIQAVLLPkkTsATVGPkAPAGGkkAsQAsQEY
  ***********************************************************************************************************************:*********::****:******
Consensus SGRGKTGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGHYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKKTSATVGPKAPAGGKKASQASQEY
Modified residues are boxed in RED. Mouse-over modified sites to view residue numbers.
Aligned using Clustal Omega. Conservation and consensus calculated using von Neumann entropy from PFAAT.