Multiple Sequence Alignment:
Lasp-1 Download MSA
  (        10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320      )
           |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |      
Lasp-1 human MNPNCARCGkIVyPTEkVNCLDkFWHKACFHCEtCkMtLNMkNYkGyEKkPyCNAHyPkQsFtMVADtPENLRLkQQsELQsQVRykEEFEkNKGkGFsVVADtPELQRIKktQDQIsNIkyHEEFEkSRMGPsGGEGMEPERRDsQDGssyRRPLEQQ---QPHHIPtsAPVyQQPQQQPVAQsyGGykEPAAPVsIQRsAPGGGGkRYRAVYDY----S--------A----------------------ADEDEVSFQDGDTIVNVQQIDDG----WMyGTVERtGDTGM---LPANyVEAI---------------------
Lasp-1 iso2 human MNPNCARCGKIVYPTEKVNCLDKFWHKACFHCETCKMTLNMKNYKGYEKKPYCNAHYPKQSFTMVADTPENLRLKQQSELQSQVRYKEEFEKNKGKGFSVVADTPELQRIKKTQDQISNIKYHEEFEKSRMGPSGGEGMEPERRDSQDGSSYRRPLEQQ---QPHHIPTSAPVYQQPQQQPVAQSYGGYKEPAAPVSIQRSAPICLQHIPRHRIRPGRDPSILQCLCFLKPATACDSYPSSSFFCQLKPSSATSAGSLLWQASPLIDFLVFSLDGTGMGLSGGGRGPWGRAGMGDLLACGPHLPLCSLPSHPPAQLLTYPHIPGLG
Lasp-1 iso3 human -------------------------------------------------------MLPLRDLQDD-TEHEELQGLREEALLQRVRYKEEFEKNKGKGFSVVADTPELQRIKKTQDQISNIKYHEEFEKSRMGPSGGEGMEPERRDSQDGSSYRRPLEQQ---QPHHIPTSAPVYQQPQQQPVAQSYGGYKEPAAPVSIQRSAPGGGGKRYRAVYDY----S--------A----------------------ADEDEVSFQDGDTIVNVQQIDDG----WMYGTVERTGDTGM---LPANYVEAI---------------------
Lasp-1 mouse MNPNCARCGKIVYPTEkVNCLDkyWHKACFHCETCKMtLNMKNYKGYEKKPyCNAHyPKQsFTMVADtPENLRLkQQSELQSQVRyKEEFEKNKGkGFsVVADtPELQRIKKTQDQISNIkYHEEFEkSRMGPSGGEGVEPERREAQDSSSYRRPtEQQ-QPQPHHIPTSAPVyQQPQQQQMTSSYGGyKEPAAPVsIQRSAPGGGGkRYRAVYDY----S--------A----------------------ADEDEVSFQDGDTIVNVQQIDDG----WMyGtVERTGDTGM---LPANYVEAI---------------------
Lasp-1 rat MNPNCARCGKIVYPTEKVNCLDkFWHKACFHCETCKMTLNMkNYkGYEKKPYCNAHYPKQSFTMVADTPENLRLKQQSELQSQVRYkEEFEKNKGkGFSVVADtPELQRIKKTQDQISNIkYHEEFEKSRMGPSGGEGIEPERREAQDSSSYRRPTEQQ-QPQPHHIPTSAPVyQQPQQQQVTPSYGGYKEPAAPVSIQRSAPGGGGKRYRAVYDY----S--------A----------------------ADEDEVSFQDGDTIVNVQQIDDG----WMYGTVERTGDTGM---LPANYVEAI---------------------
Lasp-1 rabbit MNPNCARCGKIVYPTEKVNCLDKFWHKACFHCETCKMTLNMKNYKGYEKKPYCNAHYPKQSFTMVADTPENLRLKQQSELQSQVRYKEEFEKNKGRGFsVVADTPELQRIKKTQDQISNIKYHEEFEKSRMGPSGGEGAEPERRDsQDSSNYRRPPEQQQPPQPHHIPTSTPAYQQPQPQQVAQSY-GYKEPAAPVSTQRGAPGGGGKRYRAVFDY----S--------A----------------------ADEDEVSFQDGDTIVNVQQIDDG----WMYGTVERTGDTGM---LPANYVEAI---------------------
  :::::::::::::::::::::::::::::::::::::::::::::::::::::::::*:::::::::::*:*:::::::*:::************:******************************************:*****::**:*:****:*** ..********:*:*****:*::::**:**********:**:**:::::::*:::::    *        :                      ::::::::*::::*:::::::**    :::*:::::*::**   *::::::::                     
Consensus MNPNCARCGKIVYPTEKVNCLDKFWHKACFHCETCKMTLNMKNYKGYEKKPYCNAHYPKQSFTMVADTPENLRLKQQSELQSQVRYKEEFEKNKGKGFSVVADTPELQRIKKTQDQISNIKYHEEFEKSRMGPSGGEGMEPERRDSQDGSSYRRPLEQQ--PQPHHIPTSAPVYQQPQQQQVAQSYGGYKEPAAPVSIQRSAPGGGGKRYRAVYDY----S--------A----------------------ADEDEVSFQDGDTIVNVQQIDDG----WMYGTVERTGDTGM---LPANYVEAI---------------------
Modified residues are boxed in RED. Mouse-over modified sites to view residue numbers.
Aligned using Clustal Omega. Conservation and consensus calculated using von Neumann entropy from PFAAT.