Multiple Sequence Alignment:
4E-BP1 Download MSA
  (        10        20        30        40        50        60        70        80        90       100       110         )
           |         |         |         |         |         |         |         |         |         |         |         
4E-BP1 human MsGGsSCsQtPsRAIPAT-RRVVLGdGVQLPPGDysttPGGtLFsttPGGtRIIyDRkFLMECrNsPVtktPPRDLPtIPGVtsPssDEPPMEAsQSHLRNsPEDKRAGGEEsQFEMDI
4E-BP1 mouse MsAGssCSQtPSRAIPT--RRVALGDGVQLPPGDysttPGGtLFsttPGGtRIIyDRkFLMECRNsPVAKtPPKDLPAIPGVtsPtsDEPPMQAsQsQLPssPEDKRAGGEEsQFEMDI
4E-BP1 rat MSAGSSCSQTPSRAIPT--RRVALGDGVQLPPGDYsttPGGtLFSttPGGtRIIYDRKFLMECRNsPVAKtPPKDLPTIPGVTsPTSDEPPMQASQSHLHsSPEDKRAGGEEsQFEMDI
4E-BP1 fruit fly MSASPTARQAITQALPMITRKVVISDPIQM-PEVYSSTPGGTLYSTTPGGTKLIYERAFMKNLRGSPLSQTPPSNVPSCLLRGTPRTPFRKCVPVPTELIKQT-KSLKIEDQEQFQLDL
4E-BP1 cow MSGGSSCSQTPSRAIPTT-RRVVLADGVQLPPGDYSTTPGGTLFSTTPGGTRIIYDRKFLMECRNSPVTKTPPRDLPTIPGVTSPTGDEPPTEARQNHLRSSPEDKPAGGEESQFEMDI
  **::::::*::::*:*:. *:*:::*::*::*::**:******:*******::**:*:*::::*:**:::***.::*:::::::*:::::::.:::::*.:::::::::::::**::*:
Consensus MSAGSSCSQTPSRAIPTT-RRVVLGDGVQLPPGDYSTTPGGTLFSTTPGGTRIIYDRKFLMECRNSPVAKTPPRDLPTIPGVTSPTSDEPPMQASQSHLRSSPEDKRAGGEESQFEMDI
Modified residues are boxed in RED. Mouse-over modified sites to view residue numbers.
Aligned using Clustal Omega. Conservation and consensus calculated using von Neumann entropy from PFAAT.