Multiple Sequence Alignment:
GTF2A1 Download MSA
  (        10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       350       360       370        )
           |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |        
GTF2A1 human MANSANTNtVPkLYRsVIEDVINDVRDIFLDDGVDEQVLMELKTLWENkLMQSRAVDGFHSEEQQLLLQVQQQHQPQQQQHHHHHH-HQQAQPQQTVPQQAQTQQVLIPASQQATAPQVIVPDSKLIQHMNASNM-SAAATAATLALPAGVTPVQQILTNSGQLLQVVrAANGAQYIFQPQQSVVLQQQVIPQMQPGGVQAPVIQQVLAPLPGGISPQTGVIIQPQQILFTGNKTQVIPTTVAAPTPAQAQITATGQQQPQAQPAQTQAPLVLQVDGTGDTssEEDEDEEEDYDDDEEEDKEKDGAEDGQVEEEPLNsEDDVsDEEGQELFDTENVVVCQYDKIHRSKNKWKFHLKDGIMNLNGRDYIFSKAIGDAEW
GTF2A1 mouse MANSANTNTVPKLYRSVIEDVINDVRDIFLDDGVDEQVLMELKTLWENKLMQSRAVDGFHSEEQQLLLQVQQQHQPQQQQHHHHHHQHQQAQPQQTVPQQAQTQQVLIPASQQATAPQVIVPDSKLLQHMNASSITSAAATAATLALPAGVTPVQQLLTNSGQLLQVVRAANGAQYILQPQQSVVLQQQVIPQMQPGGVQAPVIQQVLAPLPGGISPQTGVIIQPQQILFTGNKTQVIPTTVAAPAPAQAPMPAAGQQQPQAQPAQQQAPLVLQVDGTGDTSSEEDEDEEEDYDDDEEEDKEKDGAEDGQVEEEPLNsEDDVsDEEGQELFDTENVVVCQYDKIHRSKNKWKFHLKDGIMNLNGRDYIFSKAIGDAEW
GTF2A1 rat MANSANTNTVPkLYRSVIEDVINDVRDIFLDDGVDEQVLMELKTLWENKLMQSRAVDGFHSEEQQLLLQVQQQHQPQQQQHHHHHH-HQQAQPQQTVPQQAQTQQVLIPASQQATAPQVIVPDSKLIQHMNASSITSAAATAATLALPAGVTPVQQILTNSGQLLQVVRAANGAQYIFQPQQSVVLQQQVIPQMQPGGVQAPVIQQVLAPLPGGISPQTGVIIQPQQILFTGNKTQVIPTTVAAPTPAQAQIPAAGQQQPQAQPAQQQAPLVLQVDGTGDTSSEEDEDEEEDYDDDEEEDKEKDGAEDGQVEEEPLNsEDDVsDEEGQELFDTENVVVCQYDKIHRSKNKWkFHLKDGIMNLNGRDYIFSKAIGDAEW
  **************************************************************************************.***************************************:******:::********************:********************:*******************************************************************:****:::*:***********:***************************************************************************************************************
Consensus MANSANTNTVPKLYRSVIEDVINDVRDIFLDDGVDEQVLMELKTLWENKLMQSRAVDGFHSEEQQLLLQVQQQHQPQQQQHHHHHH-HQQAQPQQTVPQQAQTQQVLIPASQQATAPQVIVPDSKLIQHMNASSITSAAATAATLALPAGVTPVQQILTNSGQLLQVVRAANGAQYIFQPQQSVVLQQQVIPQMQPGGVQAPVIQQVLAPLPGGISPQTGVIIQPQQILFTGNKTQVIPTTVAAPTPAQAQIPAAGQQQPQAQPAQQQAPLVLQVDGTGDTSSEEDEDEEEDYDDDEEEDKEKDGAEDGQVEEEPLNSEDDVSDEEGQELFDTENVVVCQYDKIHRSKNKWKFHLKDGIMNLNGRDYIFSKAIGDAEW
Modified residues are boxed in RED. Mouse-over modified sites to view residue numbers.
Aligned using MAFFT. Conservation and consensus calculated using von Neumann entropy from PFAAT.