Multiple Sequence Alignment:
MRLC2V Download MSA
  (        10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160      )
           |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |      
MRLC2V human MAPKKAKKRAGGANsNVFsMFEQTQIQEFKEAFTIMDQNRDGFIDKNDLRDTFAALGRVNVKNEEIDEMIKEAPGPINFtVFLTMFGEKLKGADPEEtILNAFkVFDPEGkGVLKADyVREMLtTQAERFSKEEVDQMFAAFPPDVTGNLDykNLVHIITHGEEkD
MRLC2V mouse MAPKKAKkRIEGGssNVFsMFEQTQIQEFKEAFtIMDQNRDGFIDknDLRDTFAALGRVNVkNEEIDEMIKEAPGPINFTVFLTMFGEKLkGADPEETILNAFKVFDPEGkGsLkADyVREMLTtQAERFSkEEIDQMFAAFPPDVTGNLDYKNLVHIITHGEEkD
MRLC2V rat MSPKKAKKRLEGGssNVFSMFEQTQIQEFKEAFTIMDQNRDGFIDkNDLRDtFAALGRVNVkNEEIDEMIKEAPGPINFTVFLTMFGEKLkGADPEETILNAFKVFDPEGKGsLkADyVREMLTTQAERFSKEEIDQMFAAFPPDVTGNLDYKNLVHIITHGEEkD
  *:*******::*::**************************************************************************************************:*********************:*******************************
Consensus MAPKKAKKRAEGGSSNVFSMFEQTQIQEFKEAFTIMDQNRDGFIDKNDLRDTFAALGRVNVKNEEIDEMIKEAPGPINFTVFLTMFGEKLKGADPEETILNAFKVFDPEGKGSLKADYVREMLTTQAERFSKEEIDQMFAAFPPDVTGNLDYKNLVHIITHGEEKD
Modified residues are boxed in RED. Mouse-over modified sites to view residue numbers.
Aligned using MAFFT. Conservation and consensus calculated using von Neumann entropy from PFAAT.