Multiple Sequence Alignment: | |
G-gamma 12 | Download MSA |
( 10 20 30 40 50 60 70 ) | |
---|---|
| | | | | | | | |
G-gamma 12 human | |
G-gamma 12 mouse | |
G-gamma 12 rat | |
G-gamma 12 cow | |
*********::***********:*************************:****:***************:** | |
Consensus | MSSKTASTNNIAQARRTVQQLRLEASIERIKVSKASADLMSYCEEHARSDPLLMGIPTSENPFKDKKTCIIL |
Modified residues are boxed in RED. Mouse-over modified sites to view residue numbers. |
Aligned using MAFFT. Conservation and consensus calculated using von Neumann entropy from PFAAT. |