Multiple Sequence Alignment:
STMN1 Download MSA
  (        10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170        )
           |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |        
STMN1 human MAssDIQVkELEKrAsGQAFELILsPrskEsVPEFPLsPPkKkDLsLEEIQkkLEAAEERRksHEAEVLkQLAEkREHEkEVLQkAIEENNNFskMAEEkLtHkMEANkENREAQMAAkLERLREKDkHIEEVrKNkESkDPADEtEAD-----------------------------
STMN1 iso2 human MASSDIQVKELEKRASGQAFELILSPRSKESVPEFPLSPPKKKDLSLEEIQKKLEAAEERRKSHEAEVLKQLAEKREHEKEVLQKAIEENNNFSKMAEEKLTHKMEANKENREAQMAAKLERLREKMYFWTHG----PGAHPAQISAEQSCLHSVPALCPALGLQSALITWSDLSHHH
STMN1 mouse MAssDIQVKELEKRAsGQAFELILsPRskEsVPdFPLsPPKKKDLsLEEIQkKLEAAEERRKsHEAEVLKQLAEKREHEKEVLQKAIEENNNFSkMAEEKLTHkMEANKENREAQMAAkLERLREkDKHVEEVRKNKEskDPADETEAD-----------------------------
STMN1 rat MASsDIQVkELEKRAsGQAFELILsPRSKESVPEFPLsPPKKkDLsLEEIQKkLEAAEERRKsHEAEVLkQLAEKREHEkEVLQkAIEENNNFskMAEEkLTHkMEANkENREAQMAAkLERLREkDkHVEEVRKNkESkDPADETEAD-----------------------------
STMN1 chicken MATSDIQVKELEKRASGQAFELILGPRSKEAAPEFPLsPPKKKDLSLEEIQKKLEAAEERRKSHEAEVLKQLAEKREHEKEVLQKAIEENNNFSKMAEEKLTHKMEANKENREAQMAAKLERLREKDKHIEEVRKNKEGKDPGEAETN------------------------------
STMN1 cow MASSDIQVKELEKRASGQAFELILsPRSKESVPEFPLsPPKKKDLSLEEIQKKLEAAEERRKSHEAEVLKQLAEKREHEKEVLQKAIEENNNFSKMAEEKLTHKMEANKENREAQMAAKLERLREKDKHIEEVRKNKESKDPADETEAD-----------------------------
  **:*********************:*****::*:********************************************************************************************:::::::::::::::*:::::::                             
Consensus MASSDIQVKELEKRASGQAFELILSPRSKESVPEFPLSPPKKKDLSLEEIQKKLEAAEERRKSHEAEVLKQLAEKREHEKEVLQKAIEENNNFSKMAEEKLTHKMEANKENREAQMAAKLERLREKDKHIEEVRKNKESKDPADETEAD-----------------------------
Modified residues are boxed in RED. Mouse-over modified sites to view residue numbers.
Aligned using Clustal Omega. Conservation and consensus calculated using von Neumann entropy from PFAAT.