Multiple Sequence Alignment:
FHIT Download MSA
  (        10        20        30        40        50        60        70        80        90       100       110       120       130       140       150)
           |         |         |         |         |         |         |         |         |         |         |         |         |         |         |
FHIT human MSFRFGQHLIKPSVVFLKTELSFALVNRKPVVPGHVLVCPLRPVERFHDLRPDEVADLFQTTQRVGTVVEKHFHGTSLTFSMQDGPEAGQTVKHVHVHVLPRKAGDFHRNDsIyEELQKHDK--EDFPASWRSEEEMAAEAAALRVYFQ-
FHIT mouse MSFRFGQHLIkPSVVFLKTELSFALVNRKPVVPGHVLVCPLRPVERFRDLHPDEVADLFQVTQRVGTVVEKHFQGTSITFSMQDGPEAGQTVKHVHVHVLPRKAGDFPRNDNIYDELQKHDREEEDSPAFWRSEkEMAAEAEALRVYFQA
FHIT rat
  ***********************************************:**:*********:************:***:*****************************:***:**:******:..**:**:****:******:*******.
Consensus MSFRFGQHLIKPSVVFLKTELSFALVNRKPVVPGHVLVCPLRPVERFRDLRPDEVADLFQTTQRVGTVVEKHFQGTSITFSMQDGPEAGQTVKHVHVHVLPRKAGDFHRNDNIYDELQKHDREEEDFPAFWRSEEEMAAEAAALRVYFQA
Modified residues are boxed in RED. Mouse-over modified sites to view residue numbers.
Aligned using MAFFT. Conservation and consensus calculated using von Neumann entropy from PFAAT.