Multiple Sequence Alignment:
PTP1B Download MSA
  (        10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       350       360       370       380       390       400       410       420       430       440)
           |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |
PTP1B human MEMEkEFEQIDKsGsWAAIyQDIRHEASDFPCRVAKLPKNKNRNRyRDVsPFDHsRIkLHQEDNDyINAsLIKMEEAQRSYILTQGPLPNTCGHFWEMVWEQKSRGVVMLNRVMEKGsLKCAQYWPQKEEkEMIFEDTNLkLTLIsEDIkSyyTVRQLELENLTTQETREILHFHYTTWPDFGVPESPASFLNFLFKVRESGSLsPEHGPVVVHCSAGIGRsGtFCLADTCLLLMDKRkDPssVDIKKVLLEMRKFRMGLIQTADQLRFSYLAVIEGAKFIMGDSsVQDQWKELsHEDLEPPPEHIPPPPRPPKRILEPHNGKCR---EFFPNHQWVkEEtQE-DKDCPIkEEkGsPLNAAPyGIEsMsQDtEVRSRVVGGsLrGAQAAsPAKGEPsLP-EKDEDHALSYWKPFLVNMCVATVLTAGAYLCYRFLFNSNT
PTP1B mouse MEMEKEFEEIDKAGNWAAIYQDIRHEASDFPCKVAKLPKNKNRNRyRDVsPFDHSRIKLHQEDNDYINASLIKMEEAQRSYILTQGPLPNTCGHFWEMVWEQKSRGVVMLNRIMEKGsLKCAQYWPQQEEKEMVFDDTGLKLTLISEDVKSYYTVRQLELENLTTKETREILHFHYTTWPDFGVPESPASFLNFLFKVRESGSLSLEHGPIVVHCSAGIGRSGTFCLADTCLLLMDKRKDPSSVDIKKVLLEMRRFRMGLIQTADQLRFSYLAVIEGAKFIMGDSSVQDQWKELsREDLDLPPEHVPPPPRPPKRTLEPHNGKCK---ELFSSHQWVsEETCG-DEDSLAR-EEGRAQSSAMHSVSSMsPDTEVRRRMVGGGLQSAQASVPTEEELSSTEEEHKAHWPSHWKPFLVNVCMATLLATGAYLCYRVCFH---
PTP1B rat MEMEKEFEQIDKAGNWAAIYQDIRHEASDFPCRIAKLPKNKNRNRYRDVSPFDHSRIKLHQEDNDYINASLIKMEEAQRSYILTQGPLPNTCGHFWEMVWEQKSRGVVMLNRIMEKGSLKCAQYWPQKEEKEMVFDDTNLKLTLISEDVKSYYTVRQLELENLATQEAREILHFHYTTWPDFGVPESPASFLNFLFKVRESGSLSPEHGPIVVHCSAGIGRSGTFCLADTCLLLMDKRKDPSSVDIKKVLLEMRRFRMGLIQTADQLRFSYLAVIEGAKFIMGDSSVQDQWKELSHEDLEPPPEHVPPPPRPPKRTLEPHNGKCK---ELFSNHQWVSEEsCE-DEDILAR-EESRAPSIAVHSMSSMSQDTEVRKRMVGGGLQSAQASVPTEEELSPTEEEQKAHRPVHWKPFLVNVCMATALATGAYLCYRVCFH---
PTP1B chicken MEIEKEFHRLDQAASWAAIYQDIRHEASDFPCKVAKHPRNKNRNRYRDVSPFDHSRIKLNQGDNDyINASLIKMEEAQRSYILTQGPLPNTCGHFWEMVWEQKSRGVVMLNRVMEKGSIKCAQYWPRKEEKEMFFEDTNLKLTLISEDIKSyyTVRQLELENLTTQETREILHFHYTTWPDFGVPESPASFLNFLFKVRESGSLNPEYGPVVVHCSAGIGRSGTFCLVDTCLLLMDKRKDPSSVDVKQVLLEMRKYRMGLIQTADQLRFSYLAVIEGAKFIMGDASVQEQWKELSNEDLDPPPEHTPPPPRPPKRTSEMHNGRMHEHAEFFPKHQVVEEEIRCSVSTAEETVSDGRVFSSVPLITDSTSQDTEIRRRTVGENLHVTAHKEE---SKSESVEEDDENMMTTWKPFLVNICMFTFLTAGAYLCYRVCFH---
  **:****:.:*::::*****************::**:*:********************:*:**************************************************:*****:*******::*****:*:**:*********:**************:*:*:************************************::*:**:****************:*****************:*:******::****************************:***:******.***::****:*********::*:***::.   *:*:.**:*.**... :.:..:..:.:::.:::.....*:*:***:*.*.**:.*..::::.::..:.*...*:..::....*******:*::*.*::*******::*:   
Consensus MEMEKEFEQIDKAGNWAAIYQDIRHEASDFPCRVAKLPKNKNRNRYRDVSPFDHSRIKLHQEDNDYINASLIKMEEAQRSYILTQGPLPNTCGHFWEMVWEQKSRGVVMLNRIMEKGSLKCAQYWPQKEEKEMVFDDTNLKLTLISEDIKSYYTVRQLELENLTTQETREILHFHYTTWPDFGVPESPASFLNFLFKVRESGSLSPEHGPIVVHCSAGIGRSGTFCLADTCLLLMDKRKDPSSVDIKKVLLEMRRFRMGLIQTADQLRFSYLAVIEGAKFIMGDSSVQDQWKELSHEDLDPPPEHVPPPPRPPKRTLEPHNGKCK---ELFPNHQWVSEETCE-DEDALAR-EEGRAQSSAPHSISSMSQDTEVRRRMVGGGLQSAQASVPTEEELSETEEEDKAHAPSHWKPFLVNVCMATALAAGAYLCYRVCFH---
Modified residues are boxed in RED. Mouse-over modified sites to view residue numbers.
Aligned using Clustal Omega. Conservation and consensus calculated using von Neumann entropy from PFAAT.