Multiple Sequence Alignment:
caveolin-1 Download MSA
  (        10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170        )
           |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |        
caveolin-1 human
caveolin-1 mouse
caveolin-1 rat
caveolin-1 dog
caveolin-1 sheep
  *********************************:*..*******************************************************************::************************************************:***:***:******:**::*:*:
Consensus MSGGKYVDSEGHLYTVPIREQGNIYKPNNKAMADEMNEKQVYDAHTKEIDLVNRDPKHLNDDVVKIDFEDVIAEPEGTHSFDGIWKASFTTFTVTKYWFYRLLSALFGIPMALIWGIYFAILSFLHIWAVVPCIKSFLIEIQCISRVYSIYVHTFCDPLFEAIGKIFSNIRINTQKEI
Modified residues are boxed in RED. Mouse-over modified sites to view residue numbers.
Aligned using Clustal Omega. Conservation and consensus calculated using von Neumann entropy from PFAAT.