Multiple Sequence Alignment:
DUSP14 Download MSA
  (        10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190        )
           |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |        
DUSP14 human
DUSP14 mouse
  **************************************:*****:**********::***********************:*****:**************:*****************************:*******************:**********:******:**********:*****************
Consensus MSSRGHSTLPRTLMAPRMISEGDIGGIAQITSSLFLGRASVASNRHLLQARGITCIINATIEIPNFNWPQFEYVKVPLADIPHAPIRLYFDTVADKIHSVSRKHGATLVHCAAGVSRSATLCIAYLMKFHNLCLLEAYNWVKARRPVIRPNLGFWRQLIDYERQLFGKSSVKMVQTPYGIIPDVYEKESRHLMPYWGI
Modified residues are boxed in RED. Mouse-over modified sites to view residue numbers.
Aligned using MAFFT. Conservation and consensus calculated using von Neumann entropy from PFAAT.