Multiple Sequence Alignment:
PPP1R1A Download MSA
  (        10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170 )
           |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         | 
PPP1R1A human MEQDNsPRKIQFTVPLLEPHLDPEAAEQIRRRRPtPATLVLTSDQssPEIDEDRIPNPHLKSTLAMsPRQRKKMtRItPTMKELQMMVEHHLGQQQQGEEPEGAAESTGTQESRPPGIPDTEVESRLGTSGTAKKTAECIPKtHERGsKEPSTKEPSTHIPPLDSKGANSV
PPP1R1A mouse MEPDNsPRKIQFTVPLLEPHLDPEAAEQIRRRRPtPATLVLTsDQssPEIDEDRIPNSLLKSTLsMsPRQRKKMTRTTPTMKELQTMVEHHLGQQKQGEEPEGATESTGNQESCPPGIPDTGSASRPDTPGTAQKSAESNPKTQEQCGVEPRTEDSSAHMLPLDSQGAsLV
PPP1R1A rat MEPDNsPRKIQFTVPLLEPHLDPEAAEQIRRRRPtPATLVLTsDQssPEVDEDRIPNPLLKSTLsMsPRQRKKMTRTTPTMkELQTMVEHHLGQQKQGEEPEGATESTGNQESCPPGIPDTGSASRPDTSGTAQKPAESKPKTQEQRGVEPSTEDLSAHMLPLDSQGASLV
PPP1R1A rabbit MEQDNSPRKIQFTVPLLEPHLDPEAAEQIRRRRPtPATLVLTSDQSSPEVDEDRIPNPLLKPSLAMsPRQRKKMTRTTPTMKELQMMVEHHLGQQEQGEEPEGAAEGTGAQESQPPGTPGTGAESRLGPSATAQKPAQPSPRAQERRGEEPSTAKTSQ-----DSQGASAV
  **:**********************************************:*******::**::*:***********:********:*********.********:*:**:***.***:*:*:::**:::::**:*.*:..*:::*:.:.**:*:..*::..::**:**::*
Consensus MEQDNSPRKIQFTVPLLEPHLDPEAAEQIRRRRPTPATLVLTSDQSSPEIDEDRIPNPLLKSTLAMSPRQRKKMTRTTPTMKELQMMVEHHLGQQKQGEEPEGAAESTGNQESCPPGIPDTGSASRLDTSGTAQKPAESNPKTQERRGVEPSTEDLSAHMLPLDSQGASLV
Modified residues are boxed in RED. Mouse-over modified sites to view residue numbers.
Aligned using MAFFT. Conservation and consensus calculated using von Neumann entropy from PFAAT.