Multiple Sequence Alignment:
HSP27 Download MSA
  (        10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210   )
           |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |   
HSP27 human MTERrVPFsLLrGPsWDPFrDWyP-HsRLFDQAFGLPrLPEEWSQWLGGSSWPGyVrPLPPAAIEsPA-------VAAPAysRALsRQLssGVsEIrHtADRWRVsLDVNHFAPDELTVktkDGVVEItGkHEERQDEHGyIsRCFtRkytLPPGVDPTQVSSSLSPEGtLtVEAPMPkLAtQsNEItIPVtFEsRAQLGGPEAAksDEtAAk
HSP27 mouse MTERRVPFsLLrsPsWEPFRDWYPAHSRLFDQAFGVPRLPDEWSQWFSAAGWPGYVRPLPAATAEGPAAVtL----AAPAFsRALNRQLssGVsEIRQTADRWRVSLDVNHFAPEELTVkTkEGVVEITGKHEERQDEHGYIsRCFTRkYtLPPGVDPTLVSSSLSPEGTLTVEAPLPKAVTQsAEITIPVTFEARAQIGGPEAGksEQsGAK
HSP27 rat MTERRVPFsLLRsPsWEPFRDWYPAHsRLFDQAFGVPrFPDEWSQWFSSAGWPGYVRPLPAATAEGPAAVTL----ARPAFSRALNRQLssGVsEIRQTADRWRVsLDVNHFAPEELTVKtKEGVVEITGkHEERQDEHGYISRCFTRKYtLPPGVDPTLVSSSLSPEGTLTVEAPLPKAVTQSAEITIPVTFEARAQIGGPESEQSG---AK
HSP27 pig MTERRVPFSLLRSPSWDPFRDWYPAHSRLFDQAFGLPRLPEEWSQWLSHSGWPGYVRPLPPPAIEGPA------AVAAPAYSRLLSRQLsSGVSEIQQTADRWRVSLDVNHFAPEELTVKTKDGVVEITGKHEERQDEHGFISRCFTRKYTLPPGVDPTQVSSSLSPEGTLSVEAPLPKPATQSAEITIPVTFEARAQLGGTEAGKSEKPGTK
HSP27 hamster MTERRVPFSLLRSPsWEPFRDWYPAHSRLFDQAFGVPRLPDEWSQWFSAAGWPGYVRPLPAATAEGPAAVALAAPLAAPAFHRALNRQLsSGVSEIRQTADRWRVSLDVNHFAPEELTVKTKEGVVEITGKHEERQDEHGYISRCFTRKYTLPPGVDPTLVSSSLSPEGTLTVEAPLPKTATQSAEITIPVTFEARAQIGGQEAGKSEQSGAK
HSP27 chicken MAERRVPFTFLTSPsWEPFRDWYH-GSRLFDQSFGMPHIPEDWYKWPSGSAWPGYFRLLPSESALLPA--------PGSPYGRAL-SELSsGISEIRQSADSWKVTLDVNHFAPEELVVKTKDNIVEITGKHEEKQDEHGFISRCFTRKYTLPPGVEATAVRSSLSPDGMLTVEAPLPKPAIQSSEITIPVTVEAKKEEPAKK----------
HSP27 dog MTERRVPFSLLRSPsWDPFRDWYPAHSRLFDQAFGLPRLPEEWAQWFGHSGWPGYVRPIPPA-VEGPAAAA---AAAAPAYsRALSRQLsSGVSEIRQTADRWRVSLDVNHFAPEELTVKTKDGVVEITGKHEERQDEHGYISRRLTPKYTLPPGVDPTLVSSSLSPEGTLTVEAPMPKPATQSAEITIPVTFEARAQIGGPEAGKSEQSGAK
HSP27 cow MAERRVPFSLLRGPSWDPFRDWYPAHSRLFDQAFGLPRLPEEWSQWLSHSGWPGYVRALPAAAIEGP------------AYNRALSRQLsSGVSEIQQTADRWRVSLDVNHFAPEELTVKTKDGVVEITGKHEERQDEHGYISRCFTRKYTLPPGVDPTLVSSSLSPEGTLTVEAPLPKSATQSAEITIPVTFQARAQLGGPEAGKSEQPENK
  *:******::*::***:******:::******:**:*::*::*::*:::::****:*::*::::::*:....   .:::::.*:*:::****:***:::**:*:*:********:**:****:::*********:*****:***::*:********::*:*:*****:*:*:****:**.::**:*******:::::::::.:::::....::
Consensus MTERRVPFSLLRSPSWDPFRDWYPAHSRLFDQAFGLPRLPEEWSQWFSHSGWPGYVRPLPAAAAEGPAA-------AAPAYSRALSRQLSSGVSEIRQTADRWRVSLDVNHFAPEELTVKTKDGVVEITGKHEERQDEHGYISRCFTRKYTLPPGVDPTLVSSSLSPEGTLTVEAPLPKPATQSAEITIPVTFEARAQIGGPEAGKSEQSGAK
Modified residues are boxed in RED. Mouse-over modified sites to view residue numbers.
Aligned using Clustal Omega. Conservation and consensus calculated using von Neumann entropy from PFAAT.