Multiple Sequence Alignment:
H2B Download MSA
  (        10        20        30        40        50        60        70        80        90       100       110       120     )
           |         |         |         |         |         |         |         |         |         |         |         |     
H2B human PEPsksAPAPkkGskkAItkAQkkDGKkRKRsRkEsysIyVykVLkQVHPDtGIsskAMGIMNsFVNDIFErIAGEAsrLAHyNkrstItsrEIQtAVrLLLPGELAkHAVsEGtkAVtkytsSk
H2B mouse PEPAksAPAPkkGskkAVTkAQkkDGKKRKRsRkEsysVyVykVLkQVHPDTGIsskAMGIMNsFVNDIFERIAsEASRLAHyNkRstITsREIQtAVRLLLPGELAkHAVsEGtkAVtkYtSSk
H2B rat PEPSRSTPAPkkGskkAITkAQKKDGKKRKRGRKESYSIYVYKVLkQVHPDTGISSKAMGIMNsFVNDIFERIASEASRLAHYNkRSTITSREVQTAVRLLLPGELAkHAVsEGTkAVTkYTSSK
H2B fruit fly -PPKTSGKAAKKAG--KAQKNITKTDKKKKRKRKESYAIYIYKVLKQVHPDTGISSKAMSIMNSFVNDIFERIAAEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK
H2B cow PEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRsRKEsYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK
  ::*::*::*:**:::::::*:::*::**:**:*****::*:******************:**************:******************:*******************************
Consensus PEPAKSAPAPKKGSKKAITKAQKKDGKKRKRSRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK
Modified residues are boxed in RED. Mouse-over modified sites to view residue numbers.
Aligned using Clustal Omega. Conservation and consensus calculated using von Neumann entropy from PFAAT.