Multiple Sequence Alignment:
RGS19 Download MSA
  (        10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       )
           |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |       
RGS19 human MPTPHEAEKQITGPEEADRPPSMsSHDTASPAAPSRNPCCLCWCCCCSCSWNQERRRAWQAsREsKLQPLPsCEVCATPSPEEVQSWAQSFDKLMHsPAGRSVFRAFLRTEYSEENMLFWLACEELKAEANQHVVDEkARLIyEDyVsILsPkEVSLDSRVREGINKKMQEPSAHTFDDAQLQIYtLMHRDSYPRFLSsPtyRALLLQGPsQsssEA
RGS19 mouse MPTPHEAEKQHTGPEEADRPPSMSSHDAAPSGPPSRNPCCLCWCCCCSCSWNQERQRAWQVsREsKLQPLPsCEVCTPPsPKEVQSWAQSFDKLMHsPTGRSVFRAFLRTEYSEENMLFWLACEELKAEANQHVVDEkARLIYEDYVSILSPKEVSLDSRVREGINRKMQEPSPHTFDDAQLQIYTLMHRDSYPRFLTSPTYRSLLLQGAPQSS-EA
RGS19 rat MPTPHEAEKQHTGPEEADRPPSMSSHDAAPSGPPSRNPCCLCWCCCCSCSWNQERQRAWQVSRESKLQPLPSCEVCTPPSPEEVQSWAQSFDKLMHSPTGRSVFRAFLRTEYSEENMLFWLACEELKTEADRHVVDEKARLIYEDYVSILSPKEVSLDSRVREGINRKMQEPSPHTFDDAQLQIYTLMHRDSYPRFLTSPTYRSLLLQGAPQSS-EA
  **********:****************:*::::**********************:****:***************::***:****************:****************************:**::**********************************:******:***********************:*****:*****::***.**
Consensus MPTPHEAEKQHTGPEEADRPPSMSSHDAAPSGPPSRNPCCLCWCCCCSCSWNQERQRAWQVSRESKLQPLPSCEVCTPPSPEEVQSWAQSFDKLMHSPTGRSVFRAFLRTEYSEENMLFWLACEELKAEANQHVVDEKARLIYEDYVSILSPKEVSLDSRVREGINRKMQEPSPHTFDDAQLQIYTLMHRDSYPRFLTSPTYRSLLLQGAPQSS-EA
Modified residues are boxed in RED. Mouse-over modified sites to view residue numbers.
Aligned using Clustal Omega. Conservation and consensus calculated using von Neumann entropy from PFAAT.