Multiple Sequence Alignment:
Cofilin-1 Download MSA
  (        10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160      )
           |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |      
Cofilin-1 human MAsGVAVsDGVIkVFNDMkVRksstPEEVkkRkkAVLFCLsEDkkNIILEEGkEILVGDVGQtVDDPyAtFVkMLPDkDCRyALyDAtyEtkEskkEDLVFIFWAPEsAPLkSkMIyAsskDAIkkkLtGIkHELQANCyEEVkDRCTLAEkLGGsAVIsLEGkPL
Cofilin-1 mouse MAsGVAVsDGVIKVFNDMkVRKSstPEEVKkRkKAVLFCLsEDkkNIILEEGKEILVGDVGQTVDDPytTFVkMLPDkDCRyALyDAtyEtkESkkEDLVFIFWAPENAPLkSkMIyASSkDAIKKKLtGIKHELQANCyEEVkDRCtLAEKLGGsAVIsLEGkPL
Cofilin-1 rat MAsGVAVsDGVIkVFNDMkVRKSStPEEVkKRKKAVLFCLSEDKKNIILEEGkEILVGDVGQTVDDPyTtFVkMLPDKDCRYALYDATyETkESKKEDLVFIFWAPESAPLkSkMIYASSkDAIKKKLTGIKHELQANCyEEVKDRCTLAEKLGGsAVISLEGKPL
Cofilin-1 pig MAsGVAVSDGVIKVFNDMKVRKSSTPEEVKKRKKAVLFCLSEDKKNIILEEGKEILVGDVGQTVDDPYATFVKMLPDKDCRYALYDATYETKESKKEDLVFIFWAPECAPLKSKMIYASSKDAIKKKLTGIKHELQANCYEEVKDRCTLAEKLGGSAVISLEGKPL
  ********************************************************************:**************************************.**********************************************************
Consensus MASGVAVSDGVIKVFNDMKVRKSSTPEEVKKRKKAVLFCLSEDKKNIILEEGKEILVGDVGQTVDDPYATFVKMLPDKDCRYALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASSKDAIKKKLTGIKHELQANCYEEVKDRCTLAEKLGGSAVISLEGKPL
Modified residues are boxed in RED. Mouse-over modified sites to view residue numbers.
Aligned using Clustal Omega. Conservation and consensus calculated using von Neumann entropy from PFAAT.