Multiple Sequence Alignment:
GH Download MSA
  (        10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210        )
           |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |        
GH human MATGSRTSLLLAFGLLCLPWLQEGSAFPTIPLSRLFDNAMLRAHRLHQLAFDTYQEFEEAYIPKEQKySFLQNPQTsLCFSESIPTPSNREEtQQKsNLELLRISLLLIQSWLEPVQFLRSVFANSLVYGAsDSNVYDLLKDLEEGIQTLMGRLEDGSPRTGQIFKQTYSKFDTNsHNDDALLKNYGLLYCFRKDMDKVETFLRIVQCR-SVEGSCGF
GH mouse MATDSRTSWLLTVSLLCLLWPQEASAFPAMPLSSLFSNAVLRAQHLHQLAADTYKEFERAYIPEGQRYS-IQNAQAAFCFSETIPAPTGKEEAQQRTDMELLRFSLLLIQSWLGPVQFLSRIFTNSLMFGTSDR-VYEKLKDLEEGIQALMQELEDGSPRVGQILKQTYDKFDANMRsDDALLKNYGLLSCFKKDLHKAETYLRVMKCRRFVESSCAF
  ***:****:**:::****:*:**:****::***:**:**:***::*****:***:***:****::*:**.:**:*:::****:**:*:::**:**::::****:*********:*****:::*:***::*:**:.**::*********:**::*******:***:****:***:*:::***********:**:**::*:**:**:::**.:**:**:*
Consensus MATDSRTSLLLAFGLLCLLWLQEASAFPAIPLSRLFDNAMLRAQRLHQLAADTYQEFERAYIPEEQRYSFIQNAQAALCFSESIPAPSNREEAQQRSNLELLRISLLLIQSWLEPVQFLRRIFANSLMFGASDRNVYDLLKDLEEGIQALMQRLEDGSPRTGQILKQTYDKFDANMRNDDALLKNYGLLSCFRKDLDKAETFLRIMQCRRFVEGSCAF
Modified residues are boxed in RED. Mouse-over modified sites to view residue numbers.
Aligned using Clustal Omega. Conservation and consensus calculated using von Neumann entropy from PFAAT.