Multiple Sequence Alignment:
ICAP1 Download MSA
  (        10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200)
           |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |
ICAP1 human MFRKGKKRHSsSsSQSSEIStKsKsVDssLGGLsRsstVAsLDTDStKsSGQSNNNSDTCAEFRIkYVGAIEkLKLSEGKGLEGPLDLINYIDVAQQDGKLPFVPPEEEFIMGVSKYGIKVSTSDQYDVLHRHALYLIIRMVCYDDGLGAGKSLLALKTTDASNEEYSLWVYQCNSLEQAQAICKVLSTAFDSVLTSEkP
ICAP1 iso2 human MFRKGKKRHSSSSSQSSEISTKSKSVDSSLGGLSRSSTVASLDTDSTKSSGQSNNNSDTCAEFRIKYVGAIEKLKLSEGKGLEGPLDLINYIDVAQQDGKLPFVPPEEEFIMGVSKYGIKVSTSDQY--------------------------------------------------EQAQAICKVLSTAFDSVLTSEKP
ICAP1 mouse MFRKGKKRHSsSssQSsEIsTKSKsVDSSLGGLsRsStVAsLDTDSTKSSGQSNSNLDTCAEFRIKYVGAIEKLAVSEGKSLEGPLDLINYIDVAQQDGKLPFVPLEEEFILGVSKYGIKVsTTDQHGVLHRHALyLIIRMVCYDDGLGAGKSLLALKTTDASNEEYSLWVYQCNSLEQAQAICKVLSTAFDSVLTSDKS
ICAP1 rat MFRKGKKRHSSSSSQSSEISTKSKsVDssLGGLSRSSTVAsLDTDsTKSSGQSNSNLDTCAEFRIKYVGAIEKLAVSEGKSLEGPLDLINYIDVAQQDGKLPFVPMEEEFILGVSKYGIKVSTMDQHGVLHRHALYLIIRMVCYDDGLGAGKSLLALKTTDASNEEYSLWVYQCNSLEQAQAICKVLSTAFDSVLTSDKS
  ******************************************************:*:*****************::****:************************.*****:***********.**:.:::::::::::::::::::::::::::::::::::::::::::::::::********************:*:
Consensus MFRKGKKRHSSSSSQSSEISTKSKSVDSSLGGLSRSSTVASLDTDSTKSSGQSNNNLDTCAEFRIKYVGAIEKLALSEGKGLEGPLDLINYIDVAQQDGKLPFVPPEEEFILGVSKYGIKVSTSDQHGVLHRHALYLIIRMVCYDDGLGAGKSLLALKTTDASNEEYSLWVYQCNSLEQAQAICKVLSTAFDSVLTSDKP
Modified residues are boxed in RED. Mouse-over modified sites to view residue numbers.
Aligned using Clustal Omega. Conservation and consensus calculated using von Neumann entropy from PFAAT.