Multiple Sequence Alignment:
TEBP Download MSA
  (        10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160)
           |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |
TEBP human MQPASAkWYDRRDyVFIEFCVEDSKDVNVNFEkSkLTFsCLGGsDNFkHLNEIDLFHCIDPNDskHkRTDRsILCCLRkGEsGQsWPRLTkERAkLNWLsVDFNNWKDWEDDsDEDMsNFDRFsEMMNNMGGDEDVDLPEVdGADDDsQDsDDEKMPDLE
TEBP iso3 human MQPASAKWYDRRDYVFIEFCVEDSKDVNVNFEKSKLTFSCLGGSDNFKHLNEIDLFHCIDPNDSKHKRTDRSILCCLRKGESGQSWPRLTKERAKLNWLSVDFNNWKDWEDDsDEDMSNFDRFsED---------------------SQDsDDEKMPDLE
TEBP mouse MQPASAKWYDRRDYVFIEFCVEDSKDVNVNFEkSkLTFSCLGGsDNFkHLNEIDLFHCIDPNDSKHKRTDRSILCCLRKGEsGQsWPRLTKERAkLNWLsVDFNNWKDWEDDsDEDMsNFDRFsEMMDHMGGDEDVDLPEVDGADDDsQDsDDEKMPDLE
TEBP iso4 mouse MQPASAKWYDRRDYVFIEFCVEDSKDVNVNFEKSKLTFSCLGGSDNFKHLNEIDLFHCIDPNDSKHKRTDRSILCCLRKGESGQSWPRLTKERAK------------------------------MMDHMGGDEDVDLPEVDGADDDsQDsDDEKMPDLE
TEBP rat MQPASAkWYDRRDYVFIEFCVEDSKDVNVNFEkSKLTFSCLGGSDNFkHLNEIDLFHCIDPNDSKHKRTDRSILCCLRKGESGQSWPRLTKERAKLNWLsVDFNNWKDWEDDsDEDMsNFDRFSEMMDHMGGDEDVDLPEVDGADDDsQDsDDEKMPDLE
  ***********************************************************************************************::::::::::::::::::::::::::::::::..::::::::::::::::::*************
Consensus MQPASAKWYDRRDYVFIEFCVEDSKDVNVNFEKSKLTFSCLGGSDNFKHLNEIDLFHCIDPNDSKHKRTDRSILCCLRKGESGQSWPRLTKERAKLNWLSVDFNNWKDWEDDSDEDMSNFDRFSEMMDHMGGDEDVDLPEVDGADDDSQDSDDEKMPDLE
Modified residues are boxed in RED. Mouse-over modified sites to view residue numbers.
Aligned using Clustal Omega. Conservation and consensus calculated using von Neumann entropy from PFAAT.