Multiple Sequence Alignment:
SF3B6 Download MSA
  (        10        20        30        40        50        60        70        80        90       100       110       120     )
           |         |         |         |         |         |         |         |         |         |         |         |     
SF3B6 human
SF3B6 mouse
  *****************************************************************************************************************************
Consensus MAMQAAKRANIRLPPEVNRILYIRNLPYKITAEEMYDIFGKYGPIRQIRVGNTPETRGTAYVVYEDIFDAKNACDHLSGFNVCNRYLVVLYYNANRAFQKMDTKKKEEQLKLLKEKYGINTDPPK
Modified residues are boxed in RED. Mouse-over modified sites to view residue numbers.
Aligned using MAFFT. Conservation and consensus calculated using von Neumann entropy from PFAAT.