Multiple Sequence Alignment:
PHPT1 Download MSA
  (        10        20        30        40        50        60        70        80        90       100       110       120         )
           |         |         |         |         |         |         |         |         |         |         |         |         
PHPT1 human MAVADLALIPDVDIDsDGVFKyVLIRVHsAPRsGAPAAEskEIVRGYKWAEYHADIyDkVSGDMQkQGCDCECLGGGRISHQSQDkKIHVyGysMAyGPAQHAIS-TEKIKAkyPDyEVTWANDGy---
PHPT1 iso2 human MAVADLALIPDVDIDSDGVFKYVLIRVHSAPRSGAPAAESKEIVRGYKWAEYHADIYDKVSGDMQKQGCDCECLGGGRISHQSQDKKIHVYGYSMMRPTCVPLGASGPRIH-----HQGLWSCPARHFN
PHPT1 mouse -MAADLGQIPDVDIDsDGVFKYVLIRVHLAEPsGDPAkECKEIVRGYkWAEYHADIYDkVSGELQRNGYDCECLGGGRISHQSQDRKIHVYGySMGYGRAQHSVS-TEKIKAKYPDyEVTWADDGY---
PHPT1 rat -MAADLGQIPDVDIDsDGIFKYVLIRVHLAEPSGDPARECKEIVRGYKWAEYHADIYDKVSGELQKNGYDCECLGGGRISHQSQDRKIHVYGySMGyGRAQHSVS-TEKIKAKYPDYEVTWADDGY---
  .::***::**********:*********:*::**:**:*:**********************::*::*:****************:*********:::.::::.: :::*::::::::::*:.:::   
Consensus MAAADLAQIPDVDIDSDGVFKYVLIRVHLAERSGAPAAECKEIVRGYKWAEYHADIYDKVSGDLQKNGCDCECLGGGRISHQSQDRKIHVYGYSMGYGRAQHSVS-TEKIKAKYPDYEVTWADDGY---
Modified residues are boxed in RED. Mouse-over modified sites to view residue numbers.
Aligned using Clustal Omega. Conservation and consensus calculated using von Neumann entropy from PFAAT.