Multiple Sequence Alignment:
NAA50 Download MSA
  (        10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170     )
           |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |     
NAA50 human MkG------SRIELGDVtPHNIkQLkRLNQVIFPVsyNDkFYkDVLEVGELAkLAYFNDIAVGAVCCRVDHsQNQKRLyIMTLGCLAPYRRLGIGTkMLNHVLNICEKDGTFDNIyLHVQISNESAIDFYRkFGFEIIETkkNYykRIEPADAHVLQkNLkVPSGQNADVQktDN
NAA50 iso2 human MKG------SRIELGDVTPHNIKQLKRLNQVIFPVSYNDk----------------------------------------------------------------------------------------FyRkFGFEIIETKKNYYKRIEPADAHVLQKNLKVPSGQNADVQKTDN
NAA50 mouse MKG------SRIELGDVTPHNIkQLKRLNQVIFPVSYNDkFYkDVLEVGELAKLAYFNDIAVGAVCCRVDHSQNQKRLYIMTLGCLAPYRRLGIGTKMLNHVLNICEKDGTFDNIYLHVQISNESAIDFYRKFGFEIIETKKNYYkRIEPADAHVLQKNLKVPSGQNAETQKtDN
NAA50 iso4 mouse MPGtVGHEHSRIELGDVTPHNIKQLKRLNQVIFPVSYNDKFYKDVLEVGELAKLAYFNDIAVGAVCCRVDHSQNQKRLYIMTLGCLAPYRRLGIGTKMLNHVLNICEKDGTFDNIYLHVQISNESAIDFYRKFGFEIIETKKNYYKRIEPADAHVLQKNLKVPSGQNAETQKTDN
NAA50 rat MKG------SRIELGDVTPHNIKQLKRLNQVIFPVSYNDKFYKDVLEVGELAKLAYFNDIAVGAVCCRVDHSQNQKRLYIMTLGCLAPYRRLGIGTKMLNHVLNICEKDGTFDNIYLHVQISNESAIDFYRKFGFEIIETKKNYYKRIEPADAHVLQKSLRVPSGQSAETQKTDN
  *:*      *******************************::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::******************************:*:*****:*::*****
Consensus MKG------SRIELGDVTPHNIKQLKRLNQVIFPVSYNDKFYKDVLEVGELAKLAYFNDIAVGAVCCRVDHSQNQKRLYIMTLGCLAPYRRLGIGTKMLNHVLNICEKDGTFDNIYLHVQISNESAIDFYRKFGFEIIETKKNYYKRIEPADAHVLQKNLKVPSGQNAETQKTDN
Modified residues are boxed in RED. Mouse-over modified sites to view residue numbers.
Aligned using MAFFT. Conservation and consensus calculated using von Neumann entropy from PFAAT.