Multiple Sequence Alignment:
EIF1 Download MSA
  (        10        20        30        40        50        60        70        80        90       100       110        )
           |         |         |         |         |         |         |         |         |         |         |        
EIF1 human -----MsAIQNLHsFDPFADASkGDDLLPAGtEDyIHIRIQQRNGRktLTTVQGIADDYDkKkLVkAFKKkFACNGtVIEHPEyGEVIQLQGDQRkNICQFLVEIGLAKDDQLkVHGF
EIF1 mouse -----MsAIQNLHsFDPFADASKGDDLLPAGtEDyIHIRIQQRNGRkTLTTVQGIADDYDkKkLVKAFKKKFACNGTVIEHPEyGEVIQLQGDQRkNICQFLIEIGLAKDDQLkVHGF
EIF1 rat MrPSPMSAIQNLHSFDPFADASKGDDRLPAGTENYIRIRIQQRNSRKTLTTVQgITDDYDKKKLVKAFKKKFACNGAVIDPPDY---IQLQGAQRKNVCQLLIETGLAKDGQLKVHGF
  .....*********************:******:**:*******:**********:********************:**::*:*:::*****:****:**:*:*:*****:*******
Consensus -----MSAIQNLHSFDPFADASKGDDLLPAGTEDYIHIRIQQRNGRKTLTTVQGIADDYDKKKLVKAFKKKFACNGTVIEHPEYGEVIQLQGDQRKNICQFLIEIGLAKDDQLKVHGF
Modified residues are boxed in RED. Mouse-over modified sites to view residue numbers.
Aligned using Clustal Omega. Conservation and consensus calculated using von Neumann entropy from PFAAT.