Multiple Sequence Alignment:
PSMB1 Download MSA
  (        10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240 )
           |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         | 
PSMB1 human MLSSTAMySAPGRDLGMEPHRAAGPLQLRFSPYVFNGGTILAIAGEDFAIVASDTRLSEGFsIHtRDsPKCYkLtDktVIGCsGFHGDCLtLtkIIEARLKMYkHSNNKAMTTGAIAAMLSTILySRRFFPyYVyNIIGGLDEEGkGAVySFDPVGSyQRDsFkAGGSASAMLQPLLDNQVGFkNMQNVEHVPLsLDRAMRLVkDVFIsAAERDVyTGDALRICIVTkEGIREETVSLrkD
PSMB1 mouse MLS-TAAYRDVERELGMGPHGSAGPVQLRFSPYAFNGGTVLAIAGEDFSIVASDTRLsEGFsIHTRDsPKCYKLTDKTVIGCSGFHGDCLTLTKIIEARLKMYKHSNNKAMTTGAIAAMLSTILYSRRFFPYYVYNIIGGLDEEGKGAVySFDPVGSYQRDSFkAGGSASAMLQPLLDNQVGFKNMQNVEHVPLtLDRAMRLVkDVFIsAAERDVyTGDALRICIVTKEGIREETVPLRKD
PSMB1 rat MLS-TAAYRDPDRELVMGPQGSAGPVQMRFSPYAFNGGTVLAIAGEDFSIVASDTRLSEGFSIHTRDSPKCYKLTDKTVIGCSGFHGDCLTLTKIIEARLKMYKHSNNKAMTTGAIAAMLSTILYSRRFFPYYVYNIIEGLDEEGKGAVySFDPVGSYQRDSFkAGGSASAMLQPLLDNQVGFKNMQNVEHVPLTLDRAMRLVkDVFISAAERDVYTGDALRICIVTKEGIREETVPLRKD
  ***.**:*:::.*:*:*:*:::***:*:*****:*****:********:*****************************************************************************************:*******************************************************:*****************************************:****
Consensus MLS-TAAYRDPDRELGMGPHGSAGPVQLRFSPYAFNGGTVLAIAGEDFSIVASDTRLSEGFSIHTRDSPKCYKLTDKTVIGCSGFHGDCLTLTKIIEARLKMYKHSNNKAMTTGAIAAMLSTILYSRRFFPYYVYNIIGGLDEEGKGAVYSFDPVGSYQRDSFKAGGSASAMLQPLLDNQVGFKNMQNVEHVPLTLDRAMRLVKDVFISAAERDVYTGDALRICIVTKEGIREETVPLRKD
Modified residues are boxed in RED. Mouse-over modified sites to view residue numbers.
Aligned using Clustal Omega. Conservation and consensus calculated using von Neumann entropy from PFAAT.