Multiple Sequence Alignment:
profilin 1 Download MSA
  (        10        20        30        40        50        60        70        80        90       100       110       120       130       140)
           |         |         |         |         |         |         |         |         |         |         |         |         |         |
profilin 1 human MAGWNAyIDNLMADGtCQDAAIVGykDsPsVWAAVPGktFVNItPAEVGVLVGkDrsSFyVNGLtLGGQkCsVIRDsLLQDGEFsMDLRtkstGGAPtFNVtVtktDktLVLLMGkEGVHGGLINkkCyEMAsHLRRsQy
profilin 1 mouse MAGWNAYIDSLMADGTCQDAAIVGYKDsPSVWAAVPGkTFVsITPAEVGVLVGkDRssFFVNGLtLGGQkCSVIRDsLLQDGEFTMDLRtKstGGAPTFNVTVTMTAKTLVLLMGkEGVHGGLINkkCyEMAsHLRRsQY
profilin 1 rat MAGWNAYIDSLMADGTCQDAAIVGYKDsPsVWAAVPGKTFVSITPAEVGVLVGkDRSSFFVNGLTLGGQkCSVIRDSLLQDGEFTMDLRTKSTGGAPTFNVTVTMTAKTLVLLMGKEGVHGGLINkKCyEMASHLRRSQY
profilin 1 cow MAGWNAYIDNLMADGTCQDAAIVGYKDSPSVWAAVPGKTFVNITPAEVGILVGKDRSSFFVNGLTLGGQKCSVIRDSLLQDGEFTMDLRTKSTGGAPTFNITVTMTAKTLVLLMGKEGVHGGMINKKCyEMASHLRRsQY
  *********:*******************************:*******:*********:************************:***************:***:*:***************:*****************
Consensus MAGWNAYIDNLMADGTCQDAAIVGYKDSPSVWAAVPGKTFVNITPAEVGVLVGKDRSSFFVNGLTLGGQKCSVIRDSLLQDGEFTMDLRTKSTGGAPTFNVTVTMTAKTLVLLMGKEGVHGGLINKKCYEMASHLRRSQY
Modified residues are boxed in RED. Mouse-over modified sites to view residue numbers.
Aligned using MAFFT. Conservation and consensus calculated using von Neumann entropy from PFAAT.