Multiple Sequence Alignment:
NME3 Download MSA
  (        10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160         )
           |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         
NME3 human MICLVLTIFANLFPAACTGAHERTFLAVkPDGVQrRLVGEIVRRFERKGFkLVALKLVQAsEELLREHyAELRERPFYGRLVKYMASGPVVAMVWQGLDVVRTSRALIGAtNPADAPPGTIRGDFCIEVGKNLIHGsDSVEsARREIALWFRADELLCWEDSAGHWLYE
NME3 mouse MICLVLTIFANLFPSAYSGVNERTFLAVkPDGVQRRLVGEIVRRFERKGFKLVALKLVQASEELLREHyVELREkPFYSRLVKYMSSGPVVAMVWQGLDVVHASRALIGATDPGDAMPGTIRGDFCMEVGKNVIHGsDsVESAHREIALWFREAELLCWEDSAGHWLYE
  **************:*::*::************************************************:****:***:******:***************::********:*:**:*********:*****:**********:********::***************
Consensus MICLVLTIFANLFPAACSGANERTFLAVKPDGVQRRLVGEIVRRFERKGFKLVALKLVQASEELLREHYAELRERPFYGRLVKYMASGPVVAMVWQGLDVVRASRALIGATNPADAMPGTIRGDFCIEVGKNLIHGSDSVESARREIALWFRAAELLCWEDSAGHWLYE
Modified residues are boxed in RED. Mouse-over modified sites to view residue numbers.
Aligned using MAFFT. Conservation and consensus calculated using von Neumann entropy from PFAAT.