Multiple Sequence Alignment:
LSM4 Download MSA
  (        10        20        30        40        50        60        70        80        90       100       110       120       130         )
           |         |         |         |         |         |         |         |         |         |         |         |         |         
LSM4 human MLPLSLLKTAQNHPMLVELKNGETYNGHLVSCDNWMNINLREVICTSRDGDkFWRMPECYIrGSTIkYLRIPDEIIDMVkEEVVAKGrGrGGLQQQKQQKGrGMGGAGrGVFGGrGrGGIPGTGrGQPEKKPGRQAGkQ
LSM4 mouse MLPLsLLKTAQNHPMLVELKNGETYNGHLVSCDNWMNINLREVICTSRDGDKFWRMPECYIRGSTIKYLRIPDEIIDMVREE-AAKGRGRGGP-QQKQQKGRGMGGAGRGVFGGRGRGGIPGAGRGQPEKKPGRQAGKQ
LSM4 rat MLPLSLLKTAQNHPMLVELKNGETYNGHLVSCDNWMNINLREVICTSRDGDKFWRMPECYIRGSTIKYLRIPDEIIDMVREE-AAKGRGRGGPQQQKQQKGRGMGGAGRGVFGGRGRGGIPGAGRGQPEKKPGRQAGKQ
  *******************************************************************************:**.:********::****************************:****************
Consensus MLPLSLLKTAQNHPMLVELKNGETYNGHLVSCDNWMNINLREVICTSRDGDKFWRMPECYIRGSTIKYLRIPDEIIDMVREE-AAKGRGRGGPQQQKQQKGRGMGGAGRGVFGGRGRGGIPGAGRGQPEKKPGRQAGKQ
Modified residues are boxed in RED. Mouse-over modified sites to view residue numbers.
Aligned using MAFFT. Conservation and consensus calculated using von Neumann entropy from PFAAT.