Multiple Sequence Alignment:
NANOG Download MSA
  (        10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320)
           |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |
NANOG human MSVDPACPQSLP-CFEASDCKESSPMPVICGPEENyPSLQMSSAEMPHTEtVsPLPssMDLLIQDsPDSStsPKGKQPts-AEKSVAK-KEDKVPVKKQKTRTVFSSTQLCVLNDRFQRQKYLSLQQMQELSNILNLsYKQVKTWFQNQRMKSKRWQKNNWPKNSNGVTQKASAP-TyPSLYSSYHQGCLVNPTGNLPMWSNQtWNNSTWSNQTQN-----IQSWSNHSWNTQTWCTQS-----WNNQAWN-SPFYNCGEESLQSCMQFQPNsPASDLEAALEAAGEGLNVIQQtTRYFStPQtMDLFLNYSMNMQPEDV
NANOG mouse MSVGLPGPHSLPSSEEASNSGNASSMPAVFHP-ENYSCLQGSATEMLCTEAASPRPSSEDLPLQGSPDSSTSPKQKLSsPEADKGPEE-EENKVLARKQKMRTVFSQAQLCALKDRFQKQKYLSLQQMQELSSILNLSYkQVKTWFQNQRMKCKRWQKNQWLKTSNGLIQkGSAPVEYPSIHCSYPQGYLVNASGSLSMWGSQTWTNPTWSSQTWTNPTWNNQTWTNPTWSSQAWTAQS-----WNGQPWNAAPLHNFGEDFLQPYIQLQQNSSASDLEVNLEATRE-------SHAHFSTPQALELFLNYSVTP-PGEI
NANOG rat MSVDLSGPHSLPSCEEASNSGDSSPMPAVHLPEENYSCLQVSATEMLCTETASPPPSSGDLPLQDSPDSSSNPKLKLSGPEADEGPEKKEENKVLTKKQKMRTVFSQAQLCALKDRFQRQRyLSLQQMQDLSTILNLsYKQVKTWFQNQRMKCKRWQKNQWLKTSNGLTQKGSAPVEYPSIHCSYSQGYLMNASGNLPVWGSQTWTNPTWNNQTWTNPTWSNQTWTNPTWSNQAWSTQSWCTQAWNSQTWNAAPLHNFGEDSLQPYVPLQQNFSASDLEANLEATRE-------SQAHFSTPQALELFLNYSVNS-PGEI
  ***::::*:***:::***:::.:*:**::..*:***::**.*::**::**::**.***.**::*:*****::**.*::.::*::::::.:*:**:::***:*****::***:*:****:*:********:**.*******************:******:*:*:***::**:***::***:::**.**:*:*::*:*::*::***:*:**::**::::::.:*:*:*::*:.*:*.:**.....**.*:**::*::*:**::**::.::*:*::*****::***::*.......:.::*****:::******::..*:::
Consensus MSVDLAGPHSLPSCEEASNSGNSSPMPAVCGPEENYSCLQGSATEMLCTETASPRPSSEDLPLQDSPDSSTSPKQKLSGPEADKGPEK-EENKVLAKKQKMRTVFSQAQLCALKDRFQRQKYLSLQQMQELSNILNLSYKQVKTWFQNQRMKCKRWQKNQWLKTSNGLTQKGSAPVEYPSIHCSYHQGYLVNASGNLPMWGSQTWTNPTWSNQTWTNPTWNNQTWTNPTWSNQAWCTQS-----WNNQAWNAAPLHNFGEDSLQPYIQLQQNSSASDLEANLEATRE-------SQAHFSTPQALELFLNYSVNM-PGEI
Modified residues are boxed in RED. Mouse-over modified sites to view residue numbers.
Aligned using Clustal Omega. Conservation and consensus calculated using von Neumann entropy from PFAAT.