Multiple Sequence Alignment: | |
CYSRT1 | Download MSA |
( 10 20 30 40 50 60 70 80 90 100 110 120 130 140 ) | |
---|---|
| | | | | | | | | | | | | | | |
CYSRT1 human | |
CYSRT1 mouse | |
CYSRT1 rat | |
***:*******************:*******:::::*****:****:*:*:***::***:**:*****:**::*:**:::**:**:*:*****:**::******:**:****************:*****:******..***** | |
Consensus | MDPQEMVVKNPYAHISIPRAHLRPDLGQQLEEAPSCSSSSEMQPLPAGPCAPEPTGLLQPTEAPGPKGAKGNQGAAPEQNQQAWQQPCNPYSSGQRQAGLTYAGLPPAGRGDDIAHHCCCCPCCHCCHCPRFCRCHSCCCCVIS |
Modified residues are boxed in RED. Mouse-over modified sites to view residue numbers. |
Aligned using Clustal Omega. Conservation and consensus calculated using von Neumann entropy from PFAAT. |