Multiple Sequence Alignment:
CYSRT1 Download MSA
  (        10        20        30        40        50        60        70        80        90       100       110       120       130       140    )
           |         |         |         |         |         |         |         |         |         |         |         |         |         |    
CYSRT1 human
CYSRT1 mouse
CYSRT1 rat
  ***:*******************:*******:::::*****:****:*:*:***::***:**:*****:**::*:**:::**:**:*:*****:**::******:**:****************:*****:******..*****
Consensus MDPQEMVVKNPYAHISIPRAHLRPDLGQQLEEAPSCSSSSEMQPLPAGPCAPEPTGLLQPTEAPGPKGAKGNQGAAPEQNQQAWQQPCNPYSSGQRQAGLTYAGLPPAGRGDDIAHHCCCCPCCHCCHCPRFCRCHSCCCCVIS
Modified residues are boxed in RED. Mouse-over modified sites to view residue numbers.
Aligned using Clustal Omega. Conservation and consensus calculated using von Neumann entropy from PFAAT.