Multiple Sequence Alignment:
MED31 Download MSA
  (        10        20        30        40        50        60        70        80        90       100       110       120       130 )
           |         |         |         |         |         |         |         |         |         |         |         |         | 
MED31 human MAAAVAMEtDDAGNRLRFQLELEFVQCLANPNYLNFLAQRGYFKDKAFVNYLKYLLYWKDPEYAkYLKyPQCLHMLELLQYEHFRKELVNAQCAkFIDEQQILHWQHYSRKRMRLQQALAEQQQQNNTsGk
MED31 mouse MAAAVAMETDDAGNRLRFQLELEFVQCLANPNYLNFLAQRGYFKDKAFVNYLKYLLyWKEPEyAKYLKYPQCLHMLELLQYEHFRKELVNAQCAKFIDEQQILHWQHYSRKRVRLQQALAEQQQQNNTAGK
MED31 rat MAAAVAMETDDAGNRLRFQLELEFVQCLANPNYLNFLAQRGYFKDKAFVNYLKYLLyWKEPEYAKYLKYPQCLHMLELLQYEHFRKELVNAQCAKFIDEQQILHWQHYSRKRMRLQQALAEQQQQNTTAGK
  ***********************************************************:****************************************************:*************:*:**
Consensus MAAAVAMETDDAGNRLRFQLELEFVQCLANPNYLNFLAQRGYFKDKAFVNYLKYLLYWKEPEYAKYLKYPQCLHMLELLQYEHFRKELVNAQCAKFIDEQQILHWQHYSRKRMRLQQALAEQQQQNNTAGK
Modified residues are boxed in RED. Mouse-over modified sites to view residue numbers.
Aligned using MAFFT. Conservation and consensus calculated using von Neumann entropy from PFAAT.