Multiple Sequence Alignment:
SMR3A Download MSA
  (        10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160     )
           |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |     
SMR3A human MKSLTWILGLWALAACFTPGESQRGPRGPYPPGPLAPPPPPCFPFGTGFVPPPHPPPYGPGRFPPPLSPPYGPGRIPPSPPPPYGPGRIQSHSLPPPYGPGYPQPPSQPRPYPPGPPFFPVNSPTD------PA----LPTPAP---------------------
SMR3A mouse MKPLNLVLGLCILVGCFLSCECHRGPRRHDPRGPFPPPPPPHGP-GIG---RPHPPPFGPGIGRPP-PPPFGPGIGRPPPPPPCPP-------VPP-----HPRPPSNPSP-PPTPSIPPTGPPTTVQATTMPAASISITTPTARDSTDIFWRLWELINSLLQQE
  **:*:::***::*::**:::*::****:::*:**::*****::*.*:*...:*****:***:::**.:**:***:::*:****::*.......:**.....:*:***:*:*.**:*:::*:::**:......**....::**::.....................
Consensus MKPLNLILGLCALAACFLPCECQRGPRRHDPRGPLAPPPPPCGPFGIGFVPRPHPPPFGPGRGRPPLPPPFGPGRGRPPPPPPCGPGRIQSHSLPPPYGPGHPRPPSNPRPYPPGPPIFPTNPPTDVQATTMPAASISIPTPAARDSTDIFWRLWELINSLLQQE
Modified residues are boxed in RED. Mouse-over modified sites to view residue numbers.
Aligned using MAFFT. Conservation and consensus calculated using von Neumann entropy from PFAAT.