Multiple Sequence Alignment:
FXYD6 Download MSA
  (        10        20        30        40        50        60        70        80        90     )
           |         |         |         |         |         |         |         |         |     
FXYD6 human
FXYD6 mouse
  **:***.*******:***********:***:*****************************************************:**:*******
Consensus MELVLVFLCSLLAPMVLASAAEKEKEKDPFHYDYQTLRIGGLVFAVVLFSVGILLILSRRCKCSFNQKPRAPGDEEAQVENLITANAAEPQKAEN
Modified residues are boxed in RED. Mouse-over modified sites to view residue numbers.
Aligned using MAFFT. Conservation and consensus calculated using von Neumann entropy from PFAAT.