Multiple Sequence Alignment:
H3F3A Download MSA
  (        10        20        30        40        50        60        70        80        90       100       110       120       130     )
           |         |         |         |         |         |         |         |         |         |         |         |         |     
H3F3A human ARtkQTARkstGGkAPRkQLATkAARksAPsTGGVkkPHryrPGtVALrEIRRYQkstELLIrkLPFQRLVREIAQDFktDLrFQsAAIGALQEASEAYLVGLFEDtNLCAIHAkRVtIMPkDIQLArRIRGERA
H3F3A mouse ARTKQTARkSTGGkAPRkQLATkAARKsAPSTGGVKKPHRyRPGtVALREIRRYQkstELLIRKLPFQRLVREIAQDFktDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPkDIQLARRIRGERA
  ***************************************************************************************************************************************
Consensus ARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Modified residues are boxed in RED. Mouse-over modified sites to view residue numbers.
Aligned using Clustal Omega. Conservation and consensus calculated using von Neumann entropy from PFAAT.