Multiple Sequence Alignment:
ENY2 Download MSA
  (        10        20        30        40        50        60        70        80        90       100 )
           |         |         |         |         |         |         |         |         |         | 
ENY2 human MVVsKMNkDAQMRAAINQkLIETGERERLkELLRAkLIECGWkDQLKAHCKEVIKEkGLEHVTVDDLVAEItPkGRALVPDsVKKELLQRIRTFLAQHAsL
ENY2 mouse MVVSKMNKDAQMRAAINQKLIETGERERLKELLRAKLIECGWKDQLKAHCKEVIKEKGLEHVTVDDLVAEITPkGRALVPDSVKKELLQRIRTFLAQHAsL
ENY2 rat MVVSKMNkDAQMRAAINQkLIETGERERLkELLRAKLIECGWkDQLKAHCKEVIKEKGLEHVTVDDLVAEITPKGRALVPDSVKKELLQRIRTFLAQHASL
  *****************************************************************************************************
Consensus MVVSKMNKDAQMRAAINQKLIETGERERLKELLRAKLIECGWKDQLKAHCKEVIKEKGLEHVTVDDLVAEITPKGRALVPDSVKKELLQRIRTFLAQHASL
Modified residues are boxed in RED. Mouse-over modified sites to view residue numbers.
Aligned using Clustal Omega. Conservation and consensus calculated using von Neumann entropy from PFAAT.