Multiple Sequence Alignment:
LC3A Download MSA
  (        10        20        30        40        50        60        70        80        90       100       110       120 )
           |         |         |         |         |         |         |         |         |         |         |         | 
LC3A human MPSDRPFKQRRsFADRCKEVQQIRDQHPSKIPVIIERYKGEkQLPVLDkTkFLVPDHVNMSELVKIIRRRLQLNPTQAFFLLVNQHSMVSVsTPIADIYEQEKDEDGFLYMVYASQETFGF
LC3A iso2 human
LC3A mouse MPSDRPFKQRRsFADRCKEVQQIRDQHPSKIPVIIERYKGEKQLPVLDkTkFLVPDHVNMSELVKIIRRRLQLNPTQAFFLLVNQHSMVSVSTPIADIYEQEKDEDGFLYMVYASQETFGF
LC3A rat MPSDRPFKQRRsFADRCKEVQQIRDQHPSKIPVIIERYKGEKQLPVLDKTkFLVPDHVNMSELVKIIRRRLQLNPTQAFFLLVNQHSMVSVSTPIADIYEQEKDEDGFLYMVYASQETFGF
  *************************************************************************************************************************
Consensus MPSDRPFKQRRSFADRCKEVQQIRDQHPSKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELVKIIRRRLQLNPTQAFFLLVNQHSMVSVSTPIADIYEQEKDEDGFLYMVYASQETFGF
Modified residues are boxed in RED. Mouse-over modified sites to view residue numbers.
Aligned using Clustal Omega. Conservation and consensus calculated using von Neumann entropy from PFAAT.